SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSBTAP00000053923 from Bos taurus 69_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSBTAP00000053923
Domain Number 1 Region: 399-443
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 7.4e-16
Family Classic zinc finger, C2H2 0.0034
Further Details:      
 
Domain Number 2 Region: 432-470
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0000000000196
Family Classic zinc finger, C2H2 0.0055
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSBTAP00000053923   Gene: ENSBTAG00000046218   Transcript: ENSBTAT00000066246
Sequence length 505
Comment pep:known chromosome:UMD3.1:11:87525614:87536326:-1 gene:ENSBTAG00000046218 transcript:ENSBTAT00000066246 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MDICESILERKRHDSERSTCSILEQNDMEAVEALVCMSSWGQRSQKADLLNIRPLTPVSD
SGDVTTSVHVDTVPSELPKDFHSLSTLCMTPPQSPDLLEPLTGTVVPPQVTASKAPVVMA
VPQASAGAARVLNRTAEGGLPGPKPELLEPAASFPCRATVTGITGHAGGSPTSAHHSCPT
AQTQEHQLSACTEGEAQFLGHVETLQDMHLTDSLLSMNSVSCQPCLHKSSGLIPTNKGQQ
AGWPIGIQTCSPKNYDNDLARKATPLISIPIPSPPVLCQMIPVTGSSGLLPAVLKPPPQV
SAGLVKPVLPHAAPALPPVFVGTSVPQGTMMLLLPQGALPQPTTCSAGNMPVGNTRFLPL
APAPVFIASSQSCAPQVDFSRRRNYVCHFPGCRKTYFKSSHLKAHLRTHTGEKPFGCSWD
GCNKKFARSDELSRHRRTHTGEKKFVCPVCDRRFMRSDHLTKHARRHMATKRVPGWQAAV
GRLNRAASAEDPGSPLEPECAPASA
Download sequence
Identical sequences G3MWM1
ENSBTAP00000053923 ENSBTAP00000053923

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]