SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSBTAP00000053931 from Bos taurus 69_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSBTAP00000053931
Domain Number 1 Region: 283-341
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.22e-18
Family Classic zinc finger, C2H2 0.0047
Further Details:      
 
Domain Number 2 Region: 326-383
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0000000000181
Family Classic zinc finger, C2H2 0.0017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSBTAP00000053931   Gene: ENSBTAG00000047268   Transcript: ENSBTAT00000063508
Sequence length 398
Comment pep:known chromosome:UMD3.1:15:63913734:63965294:-1 gene:ENSBTAG00000047268 transcript:ENSBTAT00000063508 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
PLPPTRPPRLTTPSPPSPHRDAALRSWGQXEPHEEQCLSAFTVHFSGQFTGTAGACRYGP
FGPPPPSQASSGQARMFPNAPYLPSCLESQPAIRNQGYSTVTFDGTPSYGHTPSHHAAQF
PNHSFKHEDPMGQQGSLGEQQYSVPPPVYGCHTPTDSCTGSQALLLRTPYSSDNLYQMTS
QLECMTWNQMNLGATLKGVAAGSSSSVKWTEGQSNHGTGYESDNHTTPILCGAQYRIHTH
GVFRGIQDVRRVPGVAPTLVRSASETSEKRPFMCAYPGCNKRYFKLSHLQMHSRKHTGEK
PYQCDFKDCERRFSRSDQLKRHQRRHTGVKPFQCKTCQRKFSRSDHLKTHTRTHTGKTSE
KPFSCRWPSCQKKFARSDELVRHHNMHQRNMSKLQLAL
Download sequence
Identical sequences G3MWM8
ENSBTAP00000053931 ENSBTAP00000053931

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]