SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSBTAP00000053979 from Bos taurus 69_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSBTAP00000053979
Domain Number 1 Region: 477-534
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 6.24e-26
Family Classic zinc finger, C2H2 0.0051
Further Details:      
 
Domain Number 2 Region: 6-64
Classification Level Classification E-value
Superfamily KRAB domain (Kruppel-associated box) 7.59e-26
Family KRAB domain (Kruppel-associated box) 0.00093
Further Details:      
 
Domain Number 3 Region: 533-590
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.84e-25
Family Classic zinc finger, C2H2 0.0047
Further Details:      
 
Domain Number 4 Region: 421-478
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 2e-25
Family Classic zinc finger, C2H2 0.0075
Further Details:      
 
Domain Number 5 Region: 253-310
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 4.35e-25
Family Classic zinc finger, C2H2 0.0036
Further Details:      
 
Domain Number 6 Region: 309-366
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 2.25e-23
Family Classic zinc finger, C2H2 0.005
Further Details:      
 
Domain Number 7 Region: 577-636
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 7.33e-22
Family Classic zinc finger, C2H2 0.0042
Further Details:      
 
Domain Number 8 Region: 365-422
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.15e-21
Family Classic zinc finger, C2H2 0.006
Further Details:      
 
Domain Number 9 Region: 215-267
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00000000000000706
Family Classic zinc finger, C2H2 0.0055
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSBTAP00000053979   Gene: ENSBTAG00000046774   Transcript: ENSBTAT00000063869
Sequence length 650
Comment pep:known chromosome:UMD3.1:X:92807957:92830879:1 gene:ENSBTAG00000046774 transcript:ENSBTAT00000063869 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAEPQLQGLMTFEDVAVDFTQEEWQYLNPPQRTLYRDVMLETYSNLVSVGHHVTKPDLIL
KLEVEEKCLPEGKIPIWSFPDMGPQTWRRNCLYGGPISYNWIFNCAEEEACQVDEQIERQ
HQDDQDKYLMQVGFPDKKTITSKSGLDYNELGNILYLSTNLFASIQRPQKYESFGYNMVD
NLDLYSRSSVGKKYDNGCAKLFFHTEYEKTTPRVKPYGYKECGKTLRQKKGLSLHQRIKN
GEKPFECTACRKTFSKKSHLIVHWRTHTGEKPFGCTECGKAFSQKSQLIIHLRTHTGERP
FECPECGKAFREKSTVIIHYRTHTGEKPYECNECGKAFTQKSNLIVHQKTHTGEKTYECT
KCGESFIQKLDLIIHHSTHTGKKPHECNECKKTFSDKSTLIIHQRTHTGEKPHKCMECGK
SFNEKSTLIVHQRTHTGEKPYECDVCGKTFTQKSNLGVHQRTHSGEKPFECNECEKAFSQ
KSYLMLHQRGHTGEKPYECNECEKAFSQKSYLIIHQRTHTEEKPYKCNECGKAFREKSKL
IIHQRIHTGEKPYECPVCWKAFSQKSQLIIHQRTHTGEKPYACTECGKAFREKSTFTVHQ
RTHTGEKPYKCAECGKAFTQKSNLIVHQRTHTGKKAHGKGHSWKSKLIAH
Download sequence
Identical sequences Q29RN3
ENSBTAP00000053979 ENSBTAP00000053979 NP_001039776.1.59421 NP_001039776.1.76553

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]