SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSBTAP00000054102 from Bos taurus 69_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSBTAP00000054102
Domain Number 1 Region: 90-142
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00000000000000782
Family Classic zinc finger, C2H2 0.008
Further Details:      
 
Domain Number 2 Region: 128-172
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00000299
Family Classic zinc finger, C2H2 0.014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSBTAP00000054102   Gene: ENSBTAG00000047508   Transcript: ENSBTAT00000063274
Sequence length 172
Comment pep:known chromosome:UMD3.1:18:62351042:62351560:-1 gene:ENSBTAG00000047508 transcript:ENSBTAT00000063274 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MLLLPPRPPHPRASSPEAMDPPPPKAPPFPPAEGPASTASSAAGPRPPRLGRHLLIDANG
VPYTYTAPLEEEPRGPTPREAPPGEPGPRKGYSCPECARVFASPLRLQSHRVSHSDLKPF
TCGACGKAFKRSSHLSRHRATHRARAGPPHACPLCPRRFQDAAELAQHVRLH
Download sequence
Identical sequences G3MX43
ENSBTAP00000054102 ENSBTAP00000054102

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]