SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSBTAP00000054241 from Bos taurus 69_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSBTAP00000054241
Domain Number 1 Region: 17-64
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.3e-18
Family Classic zinc finger, C2H2 0.0055
Further Details:      
 
Domain Number 2 Region: 56-112
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0000000000244
Family Classic zinc finger, C2H2 0.01
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSBTAP00000054241   Gene: ENSBTAG00000046271   Transcript: ENSBTAT00000064715
Sequence length 200
Comment pep:known chromosome:UMD3.1:12:80714189:80719236:-1 gene:ENSBTAG00000046271 transcript:ENSBTAT00000064715 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
DVPRAAGRGAKARRGXNHIRVHTGEKPFPCPFPGCGKVFARSENLKIHKRTHTGEKPFKC
EFDGCDRKFANSSDRKKHSHVHTSDKPYYCKVRGCDKSYTHPSSLRKHMKIHCKSPPPSP
GALGYSSVGTPVGDPLSPVLDPTRSRSSTLSPQVTNLNEWYVCQAGGAPSHLHAPSSNGT
TSESDDEDMYANPEVVRTIH
Download sequence
Identical sequences G3MXH4
ENSBTAP00000054241 ENSBTAP00000054241

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]