SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSBTAP00000054300 from Bos taurus 69_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSBTAP00000054300
Domain Number 1 Region: 559-616
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.08e-20
Family Classic zinc finger, C2H2 0.008
Further Details:      
 
Domain Number 2 Region: 601-653
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 2.3e-20
Family Classic zinc finger, C2H2 0.0052
Further Details:      
 
Domain Number 3 Region: 521-573
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.35e-16
Family Classic zinc finger, C2H2 0.01
Further Details:      
 
Domain Number 4 Region: 195-244
Classification Level Classification E-value
Superfamily KRAB domain (Kruppel-associated box) 0.00000000000000111
Family KRAB domain (Kruppel-associated box) 0.0026
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSBTAP00000054300   Gene: ENSBTAG00000020448   Transcript: ENSBTAT00000064183
Sequence length 683
Comment pep:known chromosome:UMD3.1:4:113083336:113105071:1 gene:ENSBTAG00000020448 transcript:ENSBTAT00000064183 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MQFVSTRPQPQQLGIQGLAHEDSSWSRQREVACDSLGHPRSSHGVSCRPSLPLLCPQAQE
WDMDARRPMPFQFPPFPDRAPVFPDRMMREPQLPTAEISLWTVVAAIQAVERKVDAQASQ
LLNLEGRTGTAEKKLADCEKTAVEFGNHMEGKWAVLGTLLQEYGLLQRRLENMENLLRNR
NFWVLRLPPGSKGEVPKVPVTFVDIAVYFSEDEWKNLDEWQKELYNNLVKENYKTLMSLD
SEGPVSKPEAPSQAEPREEPCVWEQRDPEEREILMDPDTETSSLRTSHQVTGSMRVLGDL
ALLTVSDQVKSGPPTVFSASSQQPSCRGPLLLLFYTWRAYLPKPPQKLARRQPPPSQWSL
LLPTPSIITSWIRRSQSLLPTGAPNCDPCSLPAAPKQAGLSPPPPHNGTASPKSARSQST
LLSLAIPESSKGGPCGDRARIGILGAPGPSVAPGQRGAQPLTAHRTEGGGRGLHXGGGGA
GTAGGGPGGGCGSCCSPGGLRRSLLLHGGGGGGGGGGARSKPYSCPECGKSFGVRKSLII
HHRSHTKERPYECAECEKSFNCHSGLIRHQMTHRGERPYKCSECEKTYSRKEHLQNHQRL
HTGERPFQCALCGKSFIRKQNLLKHQRIHTGERPYTCGECGKSFRYKESLKDHLRVHSAG
GGGPGGGPGLGAPRPLQPPPERD
Download sequence
Identical sequences G3MXN2
ENSBTAP00000054300 ENSBTAP00000054300

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]