SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSBTAP00000054301 from Bos taurus 69_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSBTAP00000054301
Domain Number 1 Region: 543-606,868-987
Classification Level Classification E-value
Superfamily Ypt/Rab-GAP domain of gyp1p 2.12e-39
Family Ypt/Rab-GAP domain of gyp1p 0.0084
Further Details:      
 
Domain Number 2 Region: 8-96,124-201
Classification Level Classification E-value
Superfamily RUN domain-like 5.36e-33
Family RUN domain 0.0016
Further Details:      
 
Domain Number 3 Region: 963-1086
Classification Level Classification E-value
Superfamily Ypt/Rab-GAP domain of gyp1p 8.63e-28
Family Ypt/Rab-GAP domain of gyp1p 0.011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSBTAP00000054301   Gene: ENSBTAG00000045500   Transcript: ENSBTAT00000065570
Sequence length 1094
Comment pep:known chromosome:UMD3.1:19:23888014:23924563:1 gene:ENSBTAG00000045500 transcript:ENSBTAT00000065570 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGSAEDAVKEKLLWNVKKEVKQIMEEAVTRKFVHEDSSHILALCGAVEACLLHQLRRRAA
GFLRSDKMAALFTKVGKTCPVAGEICHKVQELQQQVEGSRKPLAGNQETLRRQGSASGKA
PALSLQALKHIWVRTALMEKVLDKVVQYLVENCSKYYEKEALLADPVFGPILASLLVGPC
ALEYTKLKTADHYWTDPSADELVQRHRIRGPPHRQDSPAKRPALGIRKRHSSGSASEDRL
AACAREYVESLHQNSRARLLYGKNNVLVQPKEDMEAVPGYLSLHQSAESLTLKWTPNQLM
NGTLGDSELEKSVYWDYALVVPFSQIVCIHCHQQKSGGTLVLVSQDGIQRPPLHFPQGGH
LLSFLSCLENGLLPRGQLEPPLWTQQGKGKVFPRLRKRSSLRSMDAEDVSTGRATDYVFR
IIYPGHRHEHNAGDMIEMQGFGPSLPAWHLQPLCSQGSSCLSCSTSSSPYAPPSHCSCVP
DRLPLRLLCESMKRQIVSRAFYGWLAYCRHLSTVRTHLSALVHHNIVPPARPPGASGGLT
KDVWSKYQKDEKNYKELELLRQVYYGGVEHEIRQDVWPFLLGHYKFGMSKKEMEQVDTVV
AARYQRVLAEWKACEVVVRQREREAHPATLTKFSSGSSIDSHVQRLVHRDSTISNDNVYS
CSLTPINQKLSLSSANLTDEVFVSVDDLEPPRPLGPEDPRPEAEPGAEAGPTGTAMVEQQ
SVEFDSPDSGLPSSRNYSVTSGIQSSIDEGQMGFEEEDGAGEEGSAGMDPKAQVSEPQEP
GQEKALPAGELEAGEELAAMCAAAYTVCARSPGIGDPGADGGMAWTVLEVGTEPLPQQAH
RTQCSEALGSLLSLCSFIRASPLAPDSPLRAIELLDTVALNLHRIDKDVQRCDRNYWYFT
PPNLERLRDVMCSYVWEHLDVGYVQGMCDLLAPLLVVLDNDQLAYSCFSHLMKRMSQNFP
NGGAMDAHFANMRSLIQILDSELFELMHQNGDYTHFYFCYRWFLLDFKRELPYEDVFAVW
EVIWAARHISSEHFVLFIALALVEAYREIIRDNNMDFTDIIKFFNERAEHHDAQEILRIA
RDLVHKVQTLIENK
Download sequence
Identical sequences G3MXN3
ENSBTAP00000054301 ENSBTAP00000054301

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]