SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSBTAP00000054372 from Bos taurus 69_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSBTAP00000054372
Domain Number 1 Region: 205-262
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.51e-24
Family Classic zinc finger, C2H2 0.005
Further Details:      
 
Domain Number 2 Region: 4-62
Classification Level Classification E-value
Superfamily KRAB domain (Kruppel-associated box) 2.48e-24
Family KRAB domain (Kruppel-associated box) 0.00093
Further Details:      
 
Domain Number 3 Region: 252-303
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 3.07e-18
Family Classic zinc finger, C2H2 0.008
Further Details:      
 
Domain Number 4 Region: 153-206
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00000000000000293
Family Classic zinc finger, C2H2 0.012
Further Details:      
 
Domain Number 5 Region: 107-159
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.000000807
Family Classic zinc finger, C2H2 0.018
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSBTAP00000054372   Gene: ENSBTAG00000046204   Transcript: ENSBTAT00000065604
Sequence length 319
Comment pep:known chromosome:UMD3.1:27:4996159:4999264:1 gene:ENSBTAG00000046204 transcript:ENSBTAT00000065604 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
QPFESVTFEDVAVDFTQEEWALLDTSQRKLFRDVMLENISHLVFVGYQHCKLDVIFQLEQ
GEELWIEGRGFFQSHSPGRESAFKEELLATQHISKKDTSTIIPMTFHTPEDPCECNDLGE
DFSPSSTLSQHLLTHTEKTPNISKQYQKSQSDQSYLNPHKQIHSRGKSCECHLCGKAYSN
CSSLRRHEMTHTGEKPYECHICGNAFIQSSDLRKHNLTHTGEKPYECHLCGKAFSQSSNL
RQHERTHTGEQPYECQLCGKTFSKCSALRRHERTHTGEKPYECHLCGKAFSQCSALRRHE
GTHNGEKIMNVFSKYSDLR
Download sequence
Identical sequences G3MXV1
ENSBTAP00000054372 ENSBTAP00000054372

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]