SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSBTAP00000054400 from Bos taurus 69_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSBTAP00000054400
Domain Number 1 Region: 248-298
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 2.1e-18
Family Classic zinc finger, C2H2 0.0069
Further Details:      
 
Domain Number 2 Region: 191-244
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00000000504
Family Classic zinc finger, C2H2 0.012
Further Details:      
 
Domain Number 3 Region: 289-323
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.000000585
Family Classic zinc finger, C2H2 0.023
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSBTAP00000054400   Gene: ENSBTAG00000046208   Transcript: ENSBTAT00000064865
Sequence length 352
Comment pep:known chromosome:UMD3.1:14:1782901:1788087:1 gene:ENSBTAG00000046208 transcript:ENSBTAT00000064865 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MPRSFPGQEGQTDTFSSADLESSYGRARSDLGVRLQEKGYLNDYAGPASVYDGDAEAALL
KGPSPEPMYAAAVRGELGPAAAGSAPPPTPRPELATAAGGYINGDAAVSEGYAADAFFIT
DGRSRRKAANASAAAAPSAASAPAPDGDGGGGVGAGTRGAGSGAGGRGGARAGAGTEARA
GPGAGSSGGRHACGECGKTYATSSNLSRHKQTHRSLDSQLARRCPTCGKVYVSMPAMAMH
LLTHDLRHKCGVCGKAFSRPWLLQGHMRSHTGEKPFGCAHCGKAFADRSNLRAHMQTHSA
FKHFQCKRCKKSFALKSYLNKHYESACFKGAAAGGPSAPAPTAPPQLSPVQA
Download sequence
Identical sequences G3MXX8
ENSBTAP00000054400 NP_001193752.1.59421 NP_001193752.1.76553 ENSBTAP00000054400

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]