SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSBTAP00000054418 from Bos taurus 69_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSBTAP00000054418
Domain Number 1 Region: 4-63
Classification Level Classification E-value
Superfamily KRAB domain (Kruppel-associated box) 1.31e-23
Family KRAB domain (Kruppel-associated box) 0.001
Further Details:      
 
Domain Number 2 Region: 262-319
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 2.64e-23
Family Classic zinc finger, C2H2 0.0069
Further Details:      
 
Domain Number 3 Region: 318-373
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 7.74e-23
Family Classic zinc finger, C2H2 0.0049
Further Details:      
 
Domain Number 4 Region: 224-276
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 8.64e-19
Family Classic zinc finger, C2H2 0.0036
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSBTAP00000054418   Gene: ENSBTAG00000047219   Transcript: ENSBTAT00000064067
Sequence length 373
Comment pep:known chromosome:UMD3.1:18:47431025:47437065:-1 gene:ENSBTAG00000047219 transcript:ENSBTAT00000064067 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
IEKQRPVSFKDVVVGFTQEEWHGLNPAQRALYRDVMLETYSNLVSVGYEGTKPYVILRLE
QEEAPWICEAACLGCHCWENIWQVKVHRKRRQDMLLRQGPFISRKMFPKERSHECNKCGK
ISHLGTDLFPSTQNSSNWDSCGKSVNNNLDLTGFKKNYSKKQDECYGYEKLLQHTKHDRR
QNEEKFWECSHCEKAFSHSPALMYKPPTTNSLVYKRKRVPPAEKPHVCTECGKAFCYKSE
FIRHQRSHTGEKPYGCTDCGKAFSHKSTLIKHQRIHTGVRPFECFFCGKAFTQKSHRREH
QRTHTGERPFVCNECGKSFGEKSYLNVHQKIHTGERPYRCRECGKSFSQKSCLNKHWRTH
TGEKPYGCNECGK
Download sequence
Identical sequences G3MXZ3
ENSBTAP00000054418 ENSBTAP00000054418

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]