SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSBTAP00000054547 from Bos taurus 69_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSBTAP00000054547
Domain Number 1 Region: 282-338
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 3.28e-21
Family Classic zinc finger, C2H2 0.01
Further Details:      
 
Domain Number 2 Region: 244-295
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 5.95e-18
Family Classic zinc finger, C2H2 0.0083
Further Details:      
 
Domain Number 3 Region: 323-375
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.24e-16
Family Classic zinc finger, C2H2 0.011
Further Details:      
 
Domain Number 4 Region: 1-39
Classification Level Classification E-value
Superfamily Retrovirus capsid dimerization domain-like 0.000000961
Family SCAN domain 0.0057
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSBTAP00000054547   Gene: ENSBTAG00000045803   Transcript: ENSBTAT00000062932
Sequence length 381
Comment pep:known chromosome:UMD3.1:18:63769585:63772329:1 gene:ENSBTAG00000045803 transcript:ENSBTAT00000062932 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MVDRLVLEQFVMCMPPDIQVLVKSCGAETCKDLEEVLRKKQKLTKWAVVRVQGEDFLMPV
SGVEMLGSEVNEGHSERDQAREPQSTINVVPPDEGQQESQDVQHLLGGKDLSRGQGQKAL
PPETIPETDELEGQTPSREYLVKDLLEDTGVTRTLSSQEPELLQDREGDVSTPSGSRRGP
LKNRRHVKRKRDSSPTCQDVCQEAATCLDKGEFSGQLGSHSVGASGTGGPSSLPEGAETP
GRAPSECSVCKKSFPYQSQLTLHQRTHTGERPFQCDICAKGFIQPSDLRVHQRIHTGEKP
YSCDVCLKNFAHNSTLRAHKRTHTQEKPFRCEHCDRAFGHRGNLSVHQRTHSGLKPYVCP
ECQRAFRQLGTFKRHRKIHSR
Download sequence
Identical sequences G3MYB7
ENSBTAP00000054547 ENSBTAP00000054547

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]