SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSBTAP00000054562 from Bos taurus 69_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSBTAP00000054562
Domain Number 1 Region: 497-552
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.87e-23
Family Classic zinc finger, C2H2 0.0041
Further Details:      
 
Domain Number 2 Region: 329-386
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 2.14e-23
Family Classic zinc finger, C2H2 0.0056
Further Details:      
 
Domain Number 3 Region: 273-330
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 3.18e-22
Family Classic zinc finger, C2H2 0.0056
Further Details:      
 
Domain Number 4 Region: 441-498
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 3.46e-21
Family Classic zinc finger, C2H2 0.0071
Further Details:      
 
Domain Number 5 Region: 3-60
Classification Level Classification E-value
Superfamily KRAB domain (Kruppel-associated box) 4.18e-19
Family KRAB domain (Kruppel-associated box) 0.0013
Further Details:      
 
Domain Number 6 Region: 235-287
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 7.01e-19
Family Classic zinc finger, C2H2 0.0068
Further Details:      
 
Domain Number 7 Region: 385-442
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 7.45e-18
Family Classic zinc finger, C2H2 0.0071
Further Details:      
 
Domain Number 8 Region: 539-591
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.000000116
Family Classic zinc finger, C2H2 0.024
Further Details:      
 
Domain Number 9 Region: 570-624
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.000000952
Family Classic zinc finger, C2H2 0.013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSBTAP00000054562   Gene: ENSBTAG00000009889   Transcript: ENSBTAT00000065181
Sequence length 649
Comment pep:known chromosome:UMD3.1:18:45705247:45717737:1 gene:ENSBTAG00000009889 transcript:ENSBTAT00000065181 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MFQVTFSDVAIDFSHEEWRWLNSTQRNLYKDVMVQNYENLVSLAGLSIPKPYVIALLEDG
KEPCMVEEKLSKDTFPDCKTRWENKELSMKEDIYDEDLPQMVLKEKTIQQNHEFSNFNKD
LYYIKKFKGKYENQVEHFRPVTLTFRESPIGESVYKCNAFKSIFHLKSVFSEPQRISAEG
KSHKCDILKKSLPTNSVIKNENINDGKKLLNSNESVAAFSQSKSLTLHQTLNKEKIYTCN
ECGKAFGKQSILNRHWRIHTGEKPYECHECGKTFSHGSSLTRHQISHSGEKPYKCIECGK
AFSHVSSLTNHQSTHTGEKPYECMNCGKAFSRVSHLIEHLRIHTQEKLYECRICGKAFIH
RSSLIHHQKIHTGEKPYECRECGKAFCCSSHLTRHQRIHAIEKQFECNKCLKVFSSLSFL
IQHQSIHTEEKPFECQKCGKSFNQPESLNMHLRNHTRLKPYECSICGKAFSHRSSLFQHH
RIHTGEKPYECIKCGKTFSCSSNLTVHQRIHTGEKPYKCNECGKAFSKGSNLTAHQRVHN
GEKPRKCNEYGKVSSNDISLIVYHNSHCREKPFTCNKLGKTLGKHESLKKHYTHTEEKQY
EYRNFGKSFSHSLHQRTHTEEKVYNHLKDVGSMYTHTFSFKKHEHTYHN
Download sequence
Identical sequences G3MYD0
ENSBTAP00000054562 ENSBTAP00000054562

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]