SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSBTAP00000054594 from Bos taurus 69_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSBTAP00000054594
Domain Number 1 Region: 537-594
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 9.69e-26
Family Classic zinc finger, C2H2 0.0059
Further Details:      
 
Domain Number 2 Region: 425-482
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.15e-25
Family Classic zinc finger, C2H2 0.0059
Further Details:      
 
Domain Number 3 Region: 369-426
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 9.63e-25
Family Classic zinc finger, C2H2 0.0068
Further Details:      
 
Domain Number 4 Region: 481-538
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.9e-22
Family Classic zinc finger, C2H2 0.0063
Further Details:      
 
Domain Number 5 Region: 607-659
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 3.92e-22
Family Classic zinc finger, C2H2 0.0057
Further Details:      
 
Domain Number 6 Region: 331-383
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.000000000000109
Family Classic zinc finger, C2H2 0.0092
Further Details:      
 
Domain Number 7 Region: 260-311
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00000524
Family Classic zinc finger, C2H2 0.018
Further Details:      
 
Domain Number 8 Region: 1-28
Classification Level Classification E-value
Superfamily KRAB domain (Kruppel-associated box) 0.0000248
Family KRAB domain (Kruppel-associated box) 0.0099
Further Details:      
 
Domain Number 9 Region: 139-185
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0000336
Family Classic zinc finger, C2H2 0.02
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSBTAP00000054594   Gene: ENSBTAG00000008836   Transcript: ENSBTAT00000064954
Sequence length 666
Comment pep:known chromosome:UMD3.1:8:84850370:84937203:-1 gene:ENSBTAG00000008836 transcript:ENSBTAT00000064954 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MLENYSHLVSVGYCFTKPELIFMLEQGEDPWLLEKEFINRSSPEEFQPDELLEESLENQG
KHLRQVLFINKSLTMEQEISGKPCTLDINIFPAETIPCKFDTTGSTYLLLSSLAPHCQYS
KKTYAPNVCENWLFSIKDGRTNTGENSFVCSKNVKTFGHKDKVIQHQTIQTLQQAFEYNE
CRKDFLEKTALVMSKSTHPKMKPYEFNKFGENQHEKSTLIVSQSSHPEEKSHYEFNKYEC
TKNRNNFSRITQKTDIEGKSFSQKLHTKEQEKFYIGVKSFEYGKNFSHNSTLPVHQRIHT
IEQTYDYGTCTDALGYQSACNVHKKTQIMLKPCACNECGKSCTKTSCLIQPQKSHMEEKP
FECHQCGKAFSEKSRLRKHERTHTGEKPYKCDGCEKAFSAKSGLRIHQRTHTGEKPFECN
ECGKSFNYKSILIVHQRIHTGERPFECNECGKSFSHMSGLRNHRRTHTGERPYKCDECGK
AFKLKSGLRKHHRTHTGEKPYKCNQCEKAFGQKSQLRGHHRIHTGEKPYTCNHCGEAFSQ
KSNLRVHHRTHTGEKPYKCDECGKTFRQKSNLRGHQRTHTGEKPYGCNECAKSFSEKSVL
RKHQRTHTGEKPYNCNHCGEAFSQKSNLRVHQRTHTGEKPYKCDTCGKTFSQKSSLREHQ
KAHTGK
Download sequence
Identical sequences G3MYG2
ENSBTAP00000054594 ENSBTAP00000054594

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]