SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSBTAP00000054602 from Bos taurus 69_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSBTAP00000054602
Domain Number 1 Region: 264-321
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0000000000000177
Family Classic zinc finger, C2H2 0.016
Further Details:      
 
Domain Number 2 Region: 140-199
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.000000000000089
Family Classic zinc finger, C2H2 0.0066
Further Details:      
 
Domain Number 3 Region: 189-243
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00000000202
Family Classic zinc finger, C2H2 0.016
Further Details:      
 
Domain Number 4 Region: 304-360
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00000000224
Family Classic zinc finger, C2H2 0.01
Further Details:      
 
Domain Number 5 Region: 97-154
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.000000452
Family Classic zinc finger, C2H2 0.01
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSBTAP00000054602   Gene: ENSBTAG00000009874   Transcript: ENSBTAT00000064461
Sequence length 760
Comment pep:known chromosome:UMD3.1:22:61167346:61188874:1 gene:ENSBTAG00000009874 transcript:ENSBTAT00000064461 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
GGDSLVVLLDVARGAAAAPGRREPEPEPRAASSPAGRPAQAPGAAPLGGPGAAGPQDLLV
RLERGVLALAAPSRGPPPGQEAGSPAEARRAPAGPGYRCPEPQCALAFAKKHQLQVHLLT
HGSGQGRRPFKCPLDGCGWAFTTSYKLKRHLQSHDKLRPFGCPVGGCGKKFTTVYNLKAH
MKAHEQESLFKCEVCAERFPTHAKLSSHQRSHFEPERPYKCDFPGCEKTFITVSALFSHN
RAHFREQELFSCSFPGCSKQYDKACRLKIHLRSHTGERPFICDSDSCGWTFTSMSKLLRH
KRKHDDDRRFPCPVEGCGKSFTRAEHLKGHSVTHLGTKPFACPVEGCCARFSARSSLYIH
AKKHLQDVAAPKSRCPVSSCDRLFASKHSMKAHVLRQHRRPPDFFPPLGAPSSLTPGGDP
DSPGQGEFSHVDLAVLFSDPPADGSAAPGAPDAVLGAGILTVDVTPAGASLGGDLPAGQA
SFGPMDPLVLVARGNVPPGPDSPLVLGTAAVGFQQGSLTADDVAAMGTGALGCLVAVPVK
NLDQDPHALTPSGPREASSTLEPLVPIKVEPDSPPRAQPGWQQEPGEGASRPAESSPTEQ
CSPRRDTGLAAGTGGFYLEGGGSARTDSQSVHRAKEKRQRGSGSRAGEAACAGPGRHGDP
GRGASGFKTSALCGKTCARSGSLAVPGALPCVQVQLLQDEPSGDGVLPLALSPQPPAFQP
LLAVDLPVCVLQEVLPAGGGAAVPEDLPCSGGAAGLRAWP
Download sequence
Identical sequences G3MYH0
ENSBTAP00000054602 ENSBTAP00000054602

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]