SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSBTAP00000054637 from Bos taurus 69_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSBTAP00000054637
Domain Number 1 Region: 275-332
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.77e-26
Family Classic zinc finger, C2H2 0.0031
Further Details:      
 
Domain Number 2 Region: 332-388
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 4.16e-24
Family Classic zinc finger, C2H2 0.004
Further Details:      
 
Domain Number 3 Region: 220-276
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.29e-23
Family Classic zinc finger, C2H2 0.0047
Further Details:      
 
Domain Number 4 Region: 387-444
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 2.5e-23
Family Classic zinc finger, C2H2 0.0064
Further Details:      
 
Domain Number 5 Region: 164-220
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.63e-22
Family Classic zinc finger, C2H2 0.0047
Further Details:      
 
Domain Number 6 Region: 108-164
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 4.36e-18
Family Classic zinc finger, C2H2 0.0066
Further Details:      
 
Domain Number 7 Region: 429-475
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 2.1e-16
Family Classic zinc finger, C2H2 0.0073
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSBTAP00000054637   Gene: ENSBTAG00000045791   Transcript: ENSBTAT00000065602
Sequence length 512
Comment pep:known chromosome:UMD3.1:14:2266062:2267715:-1 gene:ENSBTAG00000045791 transcript:ENSBTAT00000065602 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
VSGRGNLQKAVSEALPVMELTAPTSGRGPDPRLGRLLGNLDAQSLRSCTSQEGGFQQVTV
THWKIQTAEAAQAGSKSEGSPLLSPDLLLLQRELIEGEAPQHEACGSFPFNPVLARHQAS
HAGEKAHRCDECGKGFSQSSHLVEHQHAHGGERLYVCNACGKDFVLYTDLLEHQKVHTGE
RPFKCAQCGKAFCHSSDLIRHQRVHTRERPFECKECGKGFSQSSLLIRHQRIHTGERPYE
CNECGKAFIRSSSLIRHFQVHTEVRQYECQDCGKAFRHRSDLIEHQRIHTGERPFECNEC
GKAFIRSSKLIQHQRIHTGERPYVCNECGKRFSQTSNFTQHQRIHTGEKLYECNECGKAF
FLSSYLIRHQKIHTGERVYECKECGKAFLQKAHLTEHQKIHSGDRPFECKDCGKAFIQSS
KLLLHQIIHTGEKPYVCSYCGKGFIQRSNFLQHQKIHTEEKLYECSQYGKEFTPPPDFKS
SQEAPQEGLPLSQTAVHFGETVMDGQGCHLSL
Download sequence
Identical sequences G3MYK2
ENSBTAP00000054637 ENSBTAP00000054637

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]