SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSBTAP00000054660 from Bos taurus 69_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSBTAP00000054660
Domain Number 1 Region: 2254-2280
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0000111
Family Classic zinc finger, C2H2 0.029
Further Details:      
 
Domain Number 2 Region: 717-770
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0000111
Family Classic zinc finger, C2H2 0.022
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSBTAP00000054660   Gene: ENSBTAG00000046612   Transcript: ENSBTAT00000064161
Sequence length 2719
Comment pep:known chromosome:UMD3.1:9:63520827:63622497:-1 gene:ENSBTAG00000046612 transcript:ENSBTAT00000064161 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MADEEAEQERLSRGGGGCAAELQRLGERLQELERQLRESRVPAVEAATEYCQQLCQTLLE
YAEKWKTSEDPLPLLEVYTVAIQSYVKARPYLTSECENVALVLERLALSCVELLLCLPVE
LSDKQWEQFQTLVQVAHEKLMENGSCELHFLATLAQETGVWKNPVLCTILSQEPLDKDKV
NEFLAFEGPILLDMRIKHLIKTNQLSQATALAKLCSDHPEIGTKGSFKQTYLVCLCTSSP
NEKLIEEISEVDCKDALEMICNLESEGDEKSALVLCTAFLSRQLQQGDMYCAWELTLFWS
KLQQRVEPSIQVYLERCRQLSLLTKTVYHIFFLIKVINSETEGAGLATCIELCVKALRLE
STENTEVKISICKTISCLLPDDLEVKRACQLSEFLIEPTVDAYYAVEMLYNQPDQKYDEE
NLPIPNSLRCELLLVLKTQWPFDPEFWDWKTLKRQCLALMGEEASIVSSIDELNDSEVYE
KVADYQEDSKDTSVNGGIGANSGLRDICDEKQKKREIKQLRERGFISARFRNWQAYMQYC
VLCDKEFLGHRIVRHAQKHYKDGIYSCPICAKNFNSKETFVPHVTLHVKQSSKERLAAMK
PLRRLGRPPKITATNENQKTNAVAKQEQRPIKKNSLYSTDFIVFNDNDGSDDETDDKDKS
YEPEVIPVQKPVPVNEFNCPVTFCKKGFKYFKNLIAHVKGHKDNEDAKRFLEMQSKKVIC
QYCRRHFVSVTHLNDHLQMHCGSKPYICIQMKCKAGFNSYAELLTHRKEHQVFRAKCMFP
KCGRIFSEAYLLYDHEAQHYNTYTCKFTGCGKVYRSQSELEKHLEDHNTPEKVLPPEDQL
NSARDSVQPSRVNQSAEGNAEKERSMLPSENSVENTIPADRSGAWDKSKAESPVTKQDQI
SASELGQADGPLPNGLGNAAPTPLLQASEVAVSIKVSLNQGIEENFGKQENSTVENTGES
LVTNLHVPVENACNDLCHTDFQERKEQECFNETQITQNSLVASEALKIDGMTTQNLERQV
SNLMTFSVQNQAGFQNSLPTPKFECGGNVKTSSSLYNLPLKTLESITFVPPQPNLSNSLG
TPSVPPKAPVQKFSCQVEGCTRTYNSSQSIGKHMKTAHPDQYAAFKMQRKSKRGQKANNL
NTPNNGKFVYFLPSQVSSSNNAFFTPQTKASGTPACSAQLQHVSSSIFPAHLASVSAPLL
PSVESVMNPSIPSQDKNEQGGGLLCSQMETLSSTTLPAQMEDLTKTVLPLNIDSGSDPFL
PLPAESSSVSLFPSPADSGTNSVFSQLENNTSHFSSQIEGNTNSSFLKGGNGENAVFPSQ
VSVANDFSGAGAQQPGPEKVKKDRGRGPNGKERKPKHNKRAKWPAIIRDGKFICSRCYRA
FTNPRSLGGHLSKRSYCKPLDGAEIAQELLQNNGQPSLLASMILSTNAVNLQQPQQSAFS
AEACFKDPSFLQLLAAENRSSTFLPNTFPRTAVTSFNSSVSQEGSEIIKQALETAGIPST
FEGADVLSHVPTGCVSDTAQVNTTVMPNPPVPTLLQTVCHPGPLLTDQNGTPNPKTSSIE
ECRSLPVFPTNDLLLKTVENGLCSSSFPNSSGPSQNFTGSSSRVSVISGPQNTRSSHLNK
KGNSASKRRKKVTPPLIAPNTPQNLVTSDLTAMGLIAKSIEIPTTNLHSTVIPNCEPQGL
VENLTQKLNNVDNQLFMTDVKENFKTSLESHTVLAPLTLKTENGDSQMMALNSCTPSINS
DLQISEDNVIQNFEKTLEIIKSAMNSQILEVKNGSQGIGETSQNAQINYNIQLPSVNTVQ
NNKLSESSQFSSFIGIMPTKSNIPQSEVLHKEDQIQEILEGLQKLKLENDLSTPAPQCVL
INTSVTLTPTPVKSIPNVTVQPISEIISNIQFNDRVNKPFVCQNQGCNYSAMTKDALFKH
YGKIHQYTPEMILEIKKNQLKFAPFKCVVPTCTKTFTRNSNLRAHCQLVHHFTTEEMVKL
KIKRPYGRKSQSENSSAPRITQVKRQLALTEENKREFQPALELGAMKENTLSNIAVIPEK
QLLEKKSPEKTESSSQVIAITSEQCNTNPLTNVQTKGRKVRRHKKEKEERKRKKPVSQSP
EFPTRYSPYRPYRCVHQGCFAAFTIQQNLILHYQAVHKSDLPAFSAEVEEESEAGKESEE
IETKQTVKEFRCQVSDCSRIFQAITGLIQHYMKLHEMSPEEIESMTASVDVGKFPCDQSE
CKSSFTTYLNYVVHLEADHGIGARGSKTEEDGIYKCDCEGCDRIYATRSNLLRHIFNKHN
DKHKAHLIRPRRLTPGQENISSKANQEKTKSKHRGTKYRSGREGIKMPKTKRKKKNNLEN
KTAKIVQIEENKPYSLKRGKHVYSIKARNDALSECTSRFVTQYPCMIKGCTSVVTSESNI
IRHYKCHKLSKAFTSQHRNLLIVFKRCCSSQLKEASEQEVEKSGVKDSDTSVSESNDNAR
TAVVPQKEVVKNEKDEVDELTELFITKLINEDNTSVETQPQTSSNVSNDFKENNPCQSEK
PKASNLKRVNKEKNVSQNKKRKVEKAEPAPAVELSSIHKEEETAVAIQTTEEHPASFDWS
SFKPMGFEVSFLKFLEESAVKQKKNTDKDHPNSGSKKGSHSNSRKNVDKTAVTSGNHTCS
CKESETFVQFANPTQLQCSDSVKIVLDKTLKDCTELVLKQLQEMKPTVSLKKLEVRSNDP
DVSVMKDISMGKATGRGQY
Download sequence
Identical sequences G3MYM4
ENSBTAP00000054660 NP_001179779.1.59421 NP_001179779.1.76553 ENSBTAP00000054660

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]