SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSBTAP00000054760 from Bos taurus 69_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSBTAP00000054760
Domain Number 1 Region: 371-420
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00000555
Family Classic zinc finger, C2H2 0.042
Further Details:      
 
Domain Number 2 Region: 430-479
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0000278
Family Classic zinc finger, C2H2 0.044
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSBTAP00000054760   Gene: ENSBTAG00000046083   Transcript: ENSBTAT00000063597
Sequence length 537
Comment pep:known chromosome:UMD3.1:17:73020122:73021815:-1 gene:ENSBTAG00000046083 transcript:ENSBTAT00000063597 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAHLFPCEEAQARPQPEKKTAGSKSRDEDDGDAEVIFVGVQHVSEDAETLFVRGISSSKP
VISNILNGVTRDSSSRRKKGHVGPDPSCTSQPANLRTPASEPAAISPASQSEWGGRDNPI
IFEPSSKPDYKTSSLQAMLHNSELLSPRSHCLSGAVLSLGVKDESPLNSKRCPTSDVNFN
SGNPKRPKLSDGIPGGPASTMPSPGISPTKDTIMTLEDLLTSPSHVHGASLSRTHANNQA
CFSLMDPDRTCSLEGLEKTDFLTLASQSKTVDPMKGNLIMLLDDFYYGQHTGDRQPEQKT
YTAFKCLSCLRVLKNVKFMTHVRNHLELERQKGDGWEIHTACQHCRRQFPTPFQLQCHIE
SVHASREPSAVCKICELSFETDQVLLQHMKDSHKPGEMPYVCHVCNYRSSAFADVEAHFR
TCHGNTNNLLCLLCLRIFKLATSFVNHAWRHWNKRVFPCSRCRLQFLNLKEKTEHQTKHH
QSFKMPEQLQGLPPETEVMIRTSVQLGLRETASIIVRNTDAQVPPRKTTSRNSEKPC
Download sequence
Identical sequences G3MYX1
ENSBTAP00000054760 ENSBTAP00000054760

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]