SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSBTAP00000054844 from Bos taurus 69_3.1

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  ENSBTAP00000054844
Domain Number - Region: 33-78
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.000452
Family Classic zinc finger, C2H2 0.049
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSBTAP00000054844   Gene: ENSBTAG00000046959   Transcript: ENSBTAT00000066239
Sequence length 167
Comment pep:known chromosome:UMD3.1:1:35655412:35660398:-1 gene:ENSBTAG00000046959 transcript:ENSBTAT00000066239 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MERFVVTAPPARNRSKTALYVTPLDRVTEFGGELHEDGGKLFCTSCNVVLNHVRKSAISD
HLKSKTHTKRKAEFEEQNVRKKQRPLTASLQCNSTAQTEKVSVIQDFVKMCLEANIPLEK
ADHPAVRAFLSRHVKNGGSIPKSDQLRRAYLPDGYENENQLLNSQDC
Download sequence
Identical sequences A0A096MV76 A0A0D9SBL2 A0A1S3A7E2 A0A1S3FUS6 A0A1U7R089 A0A1U7TP14 A0A212C3I0 A0A250YAZ6 A0A287ARL7 A0A2I2Z467 A0A2K5E3A4 A0A2K5HIX4 A0A2K5RJR3 A0A2K6JRA6 A0A2K6NKS9 A0A2K6S7F0 D2HVZ4 D4ADB4 E2R433 F6RZ10 F6Z5S4 G1QFE4 G1TJG4 G3GYF2 G3MZ52 H2PA08 H2RDW8 I3NCC9 L5JME7 L5LK94 L8HTI4 L9KBD0 M3X1N6 M3Z6Z4 Q9UFW8 S7PVU3 S9Y300 U6CNE9 W5NTA4
ENSP00000381428 ENSMPUP00000019357 ENSMPUP00000019357 ENSGGOP00000015270 ENSRNOP00000000909 ENSDORP00000009973 ENSP00000381428 ENSP00000381429 ENSP00000418769 ENSP00000420374 ENSAMEP00000020803 ENSGGOP00000015270 ENSTSYP00000006589 ENSMLUP00000022427 ENSCJAP00000016134 ENSCJAP00000042684 ENSCJAP00000046323 ENSOCUP00000017092 ENSAMEP00000020803 ENSOCUP00000017092 ENSDNOP00000019452 ENSBTAP00000054844 ENSCAFP00000011505 NP_001008391.1.87134 NP_001008391.1.92137 NP_001099370.1.100692 NP_001099370.1.4139 NP_001178066.1.59421 NP_001178066.1.76553 NP_001182237.1.87134 NP_001182237.1.92137 NP_003654.3.87134 NP_003654.3.92137 XP_001135424.2.37143 XP_002716804.1.1745 XP_002926880.1.58354 XP_002926881.1.58354 XP_003255177.1.23891 XP_003255178.1.23891 XP_003255179.1.23891 XP_003255181.1.23891 XP_003318251.1.37143 XP_003497313.1.69978 XP_003831565.1.60992 XP_003831566.1.60992 XP_003831567.1.60992 XP_003928370.1.74449 XP_004002891.1.66739 XP_004035975.1.27298 XP_004091783.1.23891 XP_004272688.1.21590 XP_004321442.1.83887 XP_004371389.1.4749 XP_004440126.1.5094 XP_004448649.1.11602 XP_004706491.1.18182 XP_004778007.1.14098 XP_004778008.1.14098 XP_004778009.1.14098 XP_005076822.1.91757 XP_005334224.1.77405 XP_005345299.1.66349 XP_005606154.1.31192 XP_005638795.1.84170 XP_005638796.1.84170 XP_005878163.1.60319 XP_005908439.1.15283 XP_005908440.1.15283 XP_005964418.1.78601 XP_005964419.1.78601 XP_005964420.1.78601 XP_006040384.1.26621 XP_006057885.1.26621 XP_006057886.1.26621 XP_006090602.1.53796 XP_006155394.1.99106 XP_006188272.1.101512 XP_006215661.1.17985 XP_006248037.1.100692 XP_006768321.1.95426 XP_006926308.1.64745 XP_006936031.1.62641 XP_006981684.1.50099 XP_007082065.1.5354 XP_007126418.1.24612 XP_007164150.1.59432 XP_007164151.1.59432 XP_007451225.1.90284 XP_007530558.1.11023 XP_007628513.1.28591 XP_007984346.1.81039 XP_007984347.1.81039 XP_007984348.1.81039 XP_008059550.1.4292 XP_008153800.1.99482 XP_008533147.1.77740 XP_008581308.1.73410 XP_008702810.1.72690 XP_008766750.1.100692 XP_008830455.1.79516 XP_008984695.1.60252 XP_008984697.1.60252 XP_009236960.1.23681 XP_010337210.1.74449 XP_010372400.1.97406 XP_010372401.1.97406 XP_010846222.1.44457 XP_010964751.1.22495 XP_010964752.1.22495 XP_010976825.1.51371 XP_011284291.1.62641 XP_011354709.1.92234 XP_011732187.1.29376 XP_011732188.1.29376 XP_011782981.1.43180 XP_011782982.1.43180 XP_011782983.1.43180 XP_011782984.1.43180 XP_011782985.1.43180 XP_011804292.1.43180 XP_011832646.1.47321 XP_011832647.1.47321 XP_011832648.1.47321 XP_011832649.1.47321 XP_011832650.1.47321 XP_012006931.1.54773 XP_012310075.1.9421 XP_012310076.1.9421 XP_012353323.1.23891 XP_012589741.1.23501 XP_012879596.1.60039 XP_012879597.1.60039 XP_012879598.1.60039 XP_012973608.1.91757 XP_013208519.1.66349 XP_013208524.1.66349 XP_013208525.1.66349 XP_014199787.1.60992 XP_014312878.1.53796 XP_014312879.1.53796 XP_014337896.1.15283 XP_014404785.1.60319 XP_014708912.1.49734 XP_014921444.1.86478 XP_015324814.1.76553 XP_015334125.1.40921 XP_015334126.1.40921 XP_015422393.1.95426 XP_015455659.1.64745 XP_016052024.1.3490 XP_016052025.1.3490 XP_016797006.1.37143 XP_016797007.1.37143 XP_016797008.1.37143 XP_016826542.1.28591 XP_016862844.1.92137 XP_017399714.1.71028 XP_017399715.1.71028 XP_017512699.1.32401 XP_017512700.1.32401 XP_017512701.1.32401 XP_017707625.1.44346 XP_017910376.1.57651 XP_019285498.1.44245 XP_019285499.1.44245 XP_019479941.1.44202 XP_019479942.1.44202 XP_019479943.1.44202 XP_019479944.1.44202 XP_019600993.1.88060 XP_019600994.1.88060 XP_019600995.1.88060 XP_019663187.1.58354 XP_019820672.1.53367 XP_019820786.1.53367 XP_020033909.1.5219 XP_020926409.1.46622 XP_020926410.1.46622 XP_020926411.1.46622 XP_021545081.1.83697 XP_021545082.1.83697 XP_535549.1.84170 ENSPPYP00000015251 ENSNLEP00000014289 10116.ENSRNOP00000000909 9598.ENSPTRP00000059445 9600.ENSPPYP00000015251 9606.ENSP00000381428 9615.ENSCAFP00000011505 9796.ENSECAP00000003672 9986.ENSOCUP00000017092 ENSSTOP00000022026 ENSTSYP00000006589 ENSSTOP00000022026 ENSPTRP00000059445 ENSP00000381428 ENSP00000381429 ENSP00000418769 ENSP00000420374 ENSPANP00000003751 ENSOARP00000001395 ENSMLUP00000022427 ENSBTAP00000054844 ENSECAP00000003672 ENSPTRP00000059445 ENSRNOP00000000909 ENSCAFP00000011505 ENSPPYP00000015251 ENSNLEP00000014289 ENSDORP00000009973 ENSFCAP00000020531 ENSECAP00000003672 gi|305855078|ref|NP_001182237.1| gi|56550053|ref|NP_003654.3| gi|56550055|ref|NP_001008391.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]