SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSBTAP00000054925 from Bos taurus 69_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSBTAP00000054925
Domain Number 1 Region: 6-66
Classification Level Classification E-value
Superfamily KRAB domain (Kruppel-associated box) 2.09e-24
Family KRAB domain (Kruppel-associated box) 0.001
Further Details:      
 
Domain Number 2 Region: 266-322
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 5.82e-21
Family Classic zinc finger, C2H2 0.0075
Further Details:      
 
Domain Number 3 Region: 209-266
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 3.69e-18
Family Classic zinc finger, C2H2 0.02
Further Details:      
 
Domain Number 4 Region: 363-415
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 4e-17
Family Classic zinc finger, C2H2 0.0054
Further Details:      
 
Domain Number 5 Region: 321-378
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 6.91e-17
Family Classic zinc finger, C2H2 0.0063
Further Details:      
 
Domain Number 6 Region: 154-210
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.000000249
Family Classic zinc finger, C2H2 0.016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSBTAP00000054925   Gene: ENSBTAG00000047572   Transcript: ENSBTAT00000063489
Sequence length 425
Comment pep:known chromosome:UMD3.1:25:37408439:37419276:1 gene:ENSBTAG00000047572 transcript:ENSBTAT00000063489 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MFLPVPWKGLLSFEDVALYFTREEWDMLDWAQKALYRDVMLDNYRDVVSLGFQFPKPEVI
CQLEQWEEPWILDLPRAGTRKASGSACPDSEARFQTKELTPMENTSEDLMLWKMSALKQK
TAKEPSEELCEYNELVDIYGFSLPATGDECCKDFLQSLNLIHSRRAQTWTQQGKYDEYRK
PCHQRSQLLRHKRTLTNAKSYECHECGRAFQRQANFVRHQRLHSSENPFECDICGQAFKQ
KSTLIIHKQCHSQKKPYKCHDCGKCFRQMAYLVEHKRIHTKEKPYKCSKCERTFSQNSTL
IRHQLIHSGEKPHKCTKCGKAFGRHSTLMSHQQIHSKQNAHKCSECGESFGRNVDLIQHQ
RIHTKEEFFECRECGKTFSFKANLHRHEVIHTGERPYRCDKCGKSFSWRTSFIKHQGTHR
EQVSA
Download sequence
Identical sequences G3MZC9
ENSBTAP00000054925 ENSBTAP00000054925

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]