SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSBTAP00000054991 from Bos taurus 69_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSBTAP00000054991
Domain Number 1 Region: 296-352
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 2.07e-23
Family Classic zinc finger, C2H2 0.0064
Further Details:      
 
Domain Number 2 Region: 240-296
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.15e-20
Family Classic zinc finger, C2H2 0.0062
Further Details:      
 
Domain Number 3 Region: 352-408
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.38e-18
Family Classic zinc finger, C2H2 0.0069
Further Details:      
 
Domain Number 4 Region: 202-253
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 6.37e-18
Family Classic zinc finger, C2H2 0.0052
Further Details:      
 
Domain Number 5 Region: 11-63
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.000000000000394
Family Classic zinc finger, C2H2 0.014
Further Details:      
 
Domain Number 6 Region: 54-107
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00000000758
Family Classic zinc finger, C2H2 0.022
Further Details:      
 
Domain Number 7 Region: 96-136
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00000207
Family Classic zinc finger, C2H2 0.023
Further Details:      
 
Domain Number 8 Region: 159-212
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0000426
Family Classic zinc finger, C2H2 0.061
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSBTAP00000054991   Gene: ENSBTAG00000046984   Transcript: ENSBTAT00000063733
Sequence length 465
Comment pep:known chromosome:UMD3.1:7:43967504:43968901:1 gene:ENSBTAG00000046984 transcript:ENSBTAT00000063733 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MFAASEVAAGRPYGCSECGKSFRYSSVLLRHERVHSRDSSFRCLECGERCAEASDLRAHR
RAHAGQTLYICSECGQSFRHSGRLDLHQSVHRRRIRSCRCRACGGCFPHLPALLLHRRRW
HPPERPHRCPLCPRAFRQSALRFHLARAHPWGTPTVPADTLHRCTQCSRAFRSVAGLRSH
LRVHAARSPSDSTLRQPGAPDTHQCGVCGKSFGKSSTLTRHLQTHSGEKPFKCPECGKGF
LESATLVRHQRTHTGEKPYACSDCGRRFSESSTLLRHRRSHQGERPHACATCGKGFGQRS
DLVVHQRIHTGERPFPCTECGRCFSDRSDLTKHRRTHTGEKPYRCELCGKCFTCISNLNV
HRRNHAGHKPHKCPECGKAFSVGSKLALHRKTHLGERPAECAECGKCFSHSRSLSQHQRA
HRRARASTAPAAAATQPKAGTALIVAGQAGQEKPGLFLSQLRETC
Download sequence
Identical sequences G3MZJ3
XP_002689155.1.76553 XP_005199091.2.59421 XP_005199092.2.59421 XP_005199093.2.59421 XP_005209306.1.76553 XP_005209307.1.76553 XP_010796708.2.59421 XP_010796709.2.59421 XP_010805510.1.76553 XP_010805511.1.76553 XP_015319723.1.59421 XP_015327667.1.76553 ENSBTAP00000054991 ENSBTAP00000054991

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]