SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSBTAP00000055164 from Bos taurus 69_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSBTAP00000055164
Domain Number 1 Region: 202-259
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 4.6e-26
Family Classic zinc finger, C2H2 0.0029
Further Details:      
 
Domain Number 2 Region: 90-147
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.34e-25
Family Classic zinc finger, C2H2 0.007
Further Details:      
 
Domain Number 3 Region: 146-203
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 3.62e-24
Family Classic zinc finger, C2H2 0.003
Further Details:      
 
Domain Number 4 Region: 258-315
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 2.75e-23
Family Classic zinc finger, C2H2 0.0049
Further Details:      
 
Domain Number 5 Region: 2-62
Classification Level Classification E-value
Superfamily KRAB domain (Kruppel-associated box) 4.97e-23
Family KRAB domain (Kruppel-associated box) 0.0013
Further Details:      
 
Domain Number 6 Region: 314-371
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.3e-21
Family Classic zinc finger, C2H2 0.007
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSBTAP00000055164   Gene: ENSBTAG00000046367   Transcript: ENSBTAT00000066337
Sequence length 371
Comment pep:known chromosome:UMD3.1:18:47862388:47883111:1 gene:ENSBTAG00000046367 transcript:ENSBTAT00000066337 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAHGSLTFSDVAIGFSQQEWECLDPVQKTLYRDVMMENYGNLVSLAGHSISKPNVITLLE
QGKEPWLVVREAVLIDNGEKPYECKECGKAFSRHTDLKVHQVIHTGEKPYECKECGKAFS
RPTDLKVHQVIHTGEKPYECEECGKAFSRLTDFKVHKRIHTGEKPYECEQCGKAFSRASN
LAQHARVHTGEKCYECKECGKAFSDVGTLKIHQRIHTGEKPYECKECGKAFSQASNLIQH
DRIHTGEKPYECKDCGKAFSHASHLVRHERIHTGKKPYECKECGKAFRSSHQLTIHHRFH
TGEKPYECEACGKAFSVYGRLTRHQSIHSGERPFECNKCGKCFRLSSSLKVHQSIHTGEK
PFECHRCGKSF
Download sequence
Identical sequences G3N009
ENSBTAP00000055164 ENSBTAP00000055164

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]