SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSBTAP00000055210 from Bos taurus 69_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSBTAP00000055210
Domain Number 1 Region: 480-952
Classification Level Classification E-value
Superfamily Ribonuclease H-like 2.73e-40
Family Hermes transposase-like 0.011
Further Details:      
 
Domain Number 2 Region: 267-322
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00000000253
Family BED zinc finger 0.034
Further Details:      
 
Domain Number 3 Region: 133-187
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00000000833
Family Classic zinc finger, C2H2 0.092
Further Details:      
 
Domain Number 4 Region: 404-464
Classification Level Classification E-value
Superfamily Hermes dimerisation domain 0.00000105
Family Hermes dimerisation domain 0.015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSBTAP00000055210   Gene: ENSBTAG00000045702   Transcript: ENSBTAT00000063570
Sequence length 980
Comment pep:known chromosome:UMD3.1:16:1400457:1403399:1 gene:ENSBTAG00000045702 transcript:ENSBTAT00000063570 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSVCTLSVPVSSLSPGRRCSTFSGAGILGCVPVTSNTDEEDVVEGKMVAEGMDKEAELPT
KKKRKKGLRIKGKRRRKKLILAKKFSKDLVSGRPVADAPTLLASSAPEQDEESLFESNIE
KQIYLPSTRAKTSIVWHFFHVDPQYTWRAICNLCEKSVSRGKPGSHLGTSTLQRHLQARH
SPHWTRANKFGVTSGEEDFTLDAPLSPSSAGSSGSFEYIPADPLDNAMGKKRDKSVSDAL
RAQRGRFLIKSNIVKHALIPGTRAKTSAVWNFFYTDPQHISRAVCNICKRSVSRGRPGSH
LGTSTLQRHLQATHPIHWAVANKDSGAVGNGLDEAETERNDLLSDSLHGERSAGSQDVAA
EHLSDSDSDEPPVLEVENRRSESPTPVAEQDTQMHAQEQETAYCENSTPSQISQAIIQMI
VEDMHPYNYFSTPAFQRFLQIVAPDYRLPSETFFFTKAVPRLYDSVREKIFLTLENVQTQ
KIHLTVDIWTHDPSTDYFIVTVHWVSLETTPSFNNGRIPNFRRWAVLCVTGLAKNCLITN
ILQELNDQIGLWLSPNFLIPSFIVSDSSSNVVHAVKDGGFTHVPCFLRCLNIVIQDFFCE
HKSIENMLVAARKTCHHFSHSVKARQILQEFQNDHQLPWKNLKQDEAGHWISTFYMLKWL
LEHCYSVHHSLGRASGVVLTSLQWTLMTYVCDILKPFEEATQKVSVKTIGLNQVLPLIHH
LLLSLQKLREDFQVRGITQALNLVDSLSLKLETDTLLSAMLKSKPCILATLLDPCFKNSL
GDFFPQGADLETYKQILAEEVCNYMESSPEVSHIATSEGSGPSAIVGADSFTSSIREGTS
ISGSVDCSAADNVAIGGKSFMFPSAMAVVDEYFKEKYSEISGGDDPLFYWQKKVNIWPAL
TQVAIQYLSCPMCSWQSECVFTANSHFHPKQIMSLDFDNIEQLMFLKMNLKNVNYDYSAL
VLSWDPENEVIQSNEKEILP
Download sequence
Identical sequences G3N054
ENSBTAP00000055210 ENSBTAP00000055210

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]