SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSBTAP00000055222 from Bos taurus 69_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSBTAP00000055222
Domain Number 1 Region: 115-191
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0000000000013
Family HkH motif-containing C2H2 finger 0.045
Further Details:      
 
Domain Number 2 Region: 359-403
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0000000000115
Family Classic zinc finger, C2H2 0.043
Further Details:      
 
Domain Number 3 Region: 23-77
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0000000000128
Family HkH motif-containing C2H2 finger 0.038
Further Details:      
 
Domain Number 4 Region: 293-336
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.000000476
Family C2HC finger 0.074
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSBTAP00000055222   Gene: ENSBTAG00000046162   Transcript: ENSBTAT00000065588
Sequence length 501
Comment pep:known chromosome:UMD3.1:19:42818405:42850694:-1 gene:ENSBTAG00000046162 transcript:ENSBTAT00000065588 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MKWPLSPSPAGEKEPPVCEAAECPPRPPEAPKPKRERKRPSYTLCDVCNIQLNSAAQAQV
HCGGRAHQRRLRQLSLEKTTPGPAGPASGAPSPLLASLALPARPLQPPLDFKHLLTFHFN
GATPLSLFPNFSTMDPVQKAVISHTFGVPSPLKKKLFISCNICHLRFNSANQAEAHYKGH
KHARKLKAVEAAKSKQRPQTLTQDEMLVPPTPTPASGAPEERHSKVPAAPPPGPEIQSPR
SPEPTPREPVPSDLFDAASSSSSSSCLPCSPEPGPEAPEPEPAAVAMGSGVSGGRSEKGR
LYCPTCKVTVNASQLQAHNTGAKHRWMVEGQRGAPRRGRGRMVPRGGAGHKAKRVTGGRG
GRQGPSPPFHCALCQLQVNSETQLKQHLSSRRHKDRLAGKPPKPSSQHSKLQKHAALAVS
LLKSKLALQKQLTKTLAARFLPSPLPTAAAAICALPGPLALRPAPTAATTLFPAPILGPA
LFRTPAGAVRPATGPIVFAPY
Download sequence
Identical sequences G3N065
ENSBTAP00000055222 ENSBTAP00000055222

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]