SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSBTAP00000055235 from Bos taurus 69_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSBTAP00000055235
Domain Number 1 Region: 43-131
Classification Level Classification E-value
Superfamily Retrovirus capsid dimerization domain-like 1.83e-34
Family SCAN domain 0.0000713
Further Details:      
 
Domain Number 2 Region: 392-443
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.06e-18
Family Classic zinc finger, C2H2 0.0036
Further Details:      
 
Domain Number 3 Region: 476-527
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 2.28e-18
Family Classic zinc finger, C2H2 0.0036
Further Details:      
 
Domain Number 4 Region: 162-211
Classification Level Classification E-value
Superfamily KRAB domain (Kruppel-associated box) 3.4e-18
Family KRAB domain (Kruppel-associated box) 0.0018
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSBTAP00000055235   Gene: ENSBTAG00000003638   Transcript: ENSBTAT00000066174
Sequence length 528
Comment pep:known chromosome:UMD3.1:15:46392654:46412894:-1 gene:ENSBTAG00000003638 transcript:ENSBTAT00000066174 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MQPLSKLMTISKPHNLTPHEQSEVLRADTSWQQETIAVMETDDCEASRQKFRHFQYLEVS
GPREALSQLWELSLQWLRPEIHTKKQILELLVLEQFLTILPEEVRTWVNLQHPKNSKEVV
SLIQDVIDMLEDEGITCKDSVLHQKGSFKKEKMEADLITGKSQEPVKLEDVVVEFSKEEW
GQLDPAVKNLYRHVMLENYRNLNSLHKEHLLSKPVETSKLESKKESWIMEQEIPRTAVFD
RERISENQELVPKQRISGEESSHAVIMTRLTEGEHFPVDAWNSDDWLYRNQEPWDTNLPQ
EVFIPNIMYTEEGDFEYSENKVSADVKSVKSIFDTQQEIPMRKDSPKCDQLKTNFEFNLD
SIGKQHSEYKCGSALSLSTDIQHPKSHTTVNFYKCYQCGKAFSRSSSLIRHQIIHTGERP
YQCSECGRCFNRRSNLTKHQKIHAATKAWEGNQCGKAISEHEDSNKNPGLHSANNLYECV
KCGKSFTRGSSLTRHQTIHTGEKPFKCKQCKKTFNRSSNLLKHQKIHT
Download sequence
Identical sequences G3N078
ENSBTAP00000055235 ENSBTAP00000055235 XP_005216174.1.76553 XP_005216175.1.76553 XP_010810866.1.76553

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]