SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSBTAP00000055288 from Bos taurus 69_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSBTAP00000055288
Domain Number 1 Region: 364-416
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 6.2e-16
Family Classic zinc finger, C2H2 0.0017
Further Details:      
 
Domain Number 2 Region: 327-374
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00000000000184
Family Classic zinc finger, C2H2 0.0024
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSBTAP00000055288   Gene: ENSBTAG00000046409   Transcript: ENSBTAT00000064240
Sequence length 472
Comment pep:known chromosome:UMD3.1:28:19012870:19015927:-1 gene:ENSBTAG00000046409 transcript:ENSBTAT00000064240 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MMTAKAVDKIPVTLSGFVHQLSDNIYPVEDLAPTSVTIFPNAELGGPFDQMNGVAGDGMI
NIDMTGEKRSLDLPYPSSFAPGSAPRNQTFTYMGKFSIDPQYPGAGCYPEGIINIVSAGI
LQGVTSPASTTASSSITSASPNPLATGPLGVCTMSQTQPDLDHLYTPPPPPPYAGCGGDL
YQDPSAFLSAATTSTSSSLAYPPPPSYPSPKPATDPSLFPMIPDYPGFFPSQCQRDLHGT
AGPDRKPFPCPLDSLRVPPPLTPLSTIRNFTLGGPSAGATGPGAGGGSEGPRLPGTGSAA
AAAAAYNPHHLPLRPILRPRKYPNRPSKTPVHERPYPCPAEGCDRRFSRSDELTRHIRIH
TGHKPFQCRICMRNFSRSDHLTTHIRTHTGEKPFACDYCGRKFARSDERKRHTKIHLRQK
ERKSSAPSSAVPAASSASCSGGAQAGGTLCSSNSSTIGGGSLGPCSSRTRTP
Download sequence
Identical sequences G3N0C9
ENSBTAP00000055288 ENSBTAP00000055288

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]