SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSBTAP00000055295 from Bos taurus 69_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSBTAP00000055295
Domain Number 1 Region: 1-59
Classification Level Classification E-value
Superfamily KRAB domain (Kruppel-associated box) 5.75e-20
Family KRAB domain (Kruppel-associated box) 0.0014
Further Details:      
 
Domain Number 2 Region: 300-356
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 6.15e-18
Family Classic zinc finger, C2H2 0.019
Further Details:      
 
Domain Number 3 Region: 341-393
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0000000000000318
Family Classic zinc finger, C2H2 0.0095
Further Details:      
 
Domain Number 4 Region: 221-276
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0000000000000895
Family Classic zinc finger, C2H2 0.011
Further Details:      
 
Domain Number 5 Region: 499-556
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.000000000000622
Family Classic zinc finger, C2H2 0.015
Further Details:      
 
Domain Number 6 Region: 182-234
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0000000000539
Family Classic zinc finger, C2H2 0.011
Further Details:      
 
Domain Number 7 Region: 445-497
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.000000000287
Family Classic zinc finger, C2H2 0.012
Further Details:      
 
Domain Number 8 Region: 384-445
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.000000000357
Family Classic zinc finger, C2H2 0.0098
Further Details:      
 
Domain Number 9 Region: 545-583
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0000338
Family Classic zinc finger, C2H2 0.045
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSBTAP00000055295   Gene: ENSBTAG00000045932   Transcript: ENSBTAT00000065678
Sequence length 587
Comment pep:known chromosome:UMD3.1:28:3961784:3964691:-1 gene:ENSBTAG00000045932 transcript:ENSBTAT00000065678 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAFSQAQLTFKDVFIDFTPEEWECLNPAQRTLYRDMMVETLRNLLSVGNSLTVQCMIKKL
QAKGNSDEGEVFQRVTYERAKTHEIKDYFLREIQESMHDSTDDERNDKGMSITHNKNLTD
GRDHHSGSDTENKPLERRGSSFHDELHILQSEGTIFEYSQVVTNINSSASELAPDQEAHK
KKPYKCNECDITFLQDSELTRCQRSHTGRKTYKGNVSGKAFNANGTHEVHQRKHAREKPY
KCDVCDHCFKNTTFQIHQRTCTREKPYKCDVCGKAFSCSVHQRSHTGNKPHKCDVCCQCF
AQNTQLGIHQRIHTGEKLYKCNNCDKYFQAQQSLICHQEIHKGEKAYKCDICGRCFIQSD
YLRKHQIIHTGEERYKYNNCEKHFSSRNDFADHLRIHTVKSQTSGKPHKCGRCGKALILC
SDLTNHQEIHSELKSYIVNVCGQGFNNGCHHSHHQRIHNTETPYKYECGKSFRWHSGLKR
HQNIHAESKLQHCNECIRVFRRQSEVRIQRKLTSDREPCQCTECGKAFRYRFRLRLHQNI
HPGVKTYKYNFCGKDFPQTSKLGIPPKIHIGQNPYNYNEFGKILGQF
Download sequence
Identical sequences G3N0D6
ENSBTAP00000055295 ENSBTAP00000055295

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]