SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSBTAP00000055306 from Bos taurus 69_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSBTAP00000055306
Domain Number 1 Region: 276-333
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 4.75e-25
Family Classic zinc finger, C2H2 0.0028
Further Details:      
 
Domain Number 2 Region: 332-389
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 4.78e-24
Family Classic zinc finger, C2H2 0.0056
Further Details:      
 
Domain Number 3 Region: 389-445
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 2e-21
Family Classic zinc finger, C2H2 0.0064
Further Details:      
 
Domain Number 4 Region: 24-81
Classification Level Classification E-value
Superfamily KRAB domain (Kruppel-associated box) 2.22e-21
Family KRAB domain (Kruppel-associated box) 0.001
Further Details:      
 
Domain Number 5 Region: 430-482
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 2.83e-21
Family Classic zinc finger, C2H2 0.004
Further Details:      
 
Domain Number 6 Region: 143-193
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0000000276
Family Classic zinc finger, C2H2 0.012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSBTAP00000055306   Gene: ENSBTAG00000040358   Transcript: ENSBTAT00000064597
Sequence length 491
Comment pep:known chromosome:UMD3.1:18:64856654:64862504:-1 gene:ENSBTAG00000040358 transcript:ENSBTAT00000064597 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
PVALQPLAFPSPQVPMAAAVLTDPAQGNVTFEDVFVSFSQEEWGLLDEAQRLLYREVMLE
NFALMASLGYASSMSHGVSPQELGREPWVSDWANTIPALTREAQSAGSPGCWHGMEDDEI
RFEQSISIKRVSKGMIPKTIPSSQKAHPCETCGPILRDVLHMAEHQETRPGQKPYLCVAC
GKQLWFSANFPLHNQHSGEKPHRRDVHRALLVSSCPVQSSETPFTTGEGCEDFPTSSSMF
QQHYPLSKWKPQSDTHCAEVFHSGQKHYECSECGKAFSRKDSLVQHQRVHTGERPYKCSE
CGKTFSRKPILAQHQRIHTGEMPYECGICGKVFNHSSNLIVHQRVHTGARPYKCSECGKA
YSHKSTLVQHESIHTGERPYECSECGKYFGHKYRLIKHWSVHTGARPYECIACGKFFSQS
SDLIAHQRVHNGEKPYVCSECGKAFSHKHVLMQHLRIHTGERPYKCSECGKAFRQRASLI
RHWKVHAGERP
Download sequence
Identical sequences G3N0E6
ENSBTAP00000055306 ENSBTAP00000055306

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]