SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSBTAP00000055316 from Bos taurus 69_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSBTAP00000055316
Domain Number 1 Region: 307-445
Classification Level Classification E-value
Superfamily Spectrin repeat 9.6e-20
Family Spectrin repeat 0.0069
Further Details:      
 
Domain Number 2 Region: 121-232
Classification Level Classification E-value
Superfamily Spectrin repeat 2.36e-19
Family Spectrin repeat 0.0027
Further Details:      
 
Domain Number 3 Region: 240-341
Classification Level Classification E-value
Superfamily Spectrin repeat 0.000000000000329
Family Spectrin repeat 0.0042
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSBTAP00000055316   Gene: ENSBTAG00000046838   Transcript: ENSBTAT00000064445
Sequence length 565
Comment pep:known chromosome:UMD3.1:X:115892940:116081425:1 gene:ENSBTAG00000046838 transcript:ENSBTAT00000064445 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
DVATTYPDKKSILMYVTSLFQVLPQQVSLEAIQEVEMLPRPSKVTREEHFQLHHQMHYSQ
QITVSLAQGYERTPSSPQPRFKSYAYTQAAYVSTSDPTRSPFPSQRLEAPEDKSFGSPLM
ETEVNLDSYQTALEEVLSWLLSAEDTLQAQGEISNDVEEVKEQFHTHEGYMMDLTSHQGR
VGNVLQLGSQLIGSGKLSEDEETEVQEQMNLLNSRWECLRVASMEKQSNLHKVLMDLQNQ
QLKELNAWLTKTEERTRKMEKEPLGPDLEDLKRQIQQHKVLQEDLEQEQVRVNSLTHMVV
VVDESSGDHATAALEEQLKVLGDRWANICRWTEDRWVLLQDVLLKWQRFTEEQCLFSTWL
SDKEDALNKIPTSGFKDQSEMLSSLQKLAVLKTDLEKKKQTMDKLCSLNHDLLSTLKNTL
VAQKMEAWLDNFAQRWDNLVQKLEKSSTQISQAVTTTQPSLTQTTVMETVTMVTTREQIL
VKHAQEELPPPPPQKKRQIIVDSEIKKRLDVDITELHSWITRSEAVLQSPEFAVYRKEGN
FSDLKEKVNVGYALIFMYFSNFCCL
Download sequence
Identical sequences G3N0F6
ENSBTAP00000055316 ENSBTAP00000055316

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]