SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSBTAP00000055347 from Bos taurus 69_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSBTAP00000055347
Domain Number 1 Region: 451-508
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 4.03e-22
Family Classic zinc finger, C2H2 0.0076
Further Details:      
 
Domain Number 2 Region: 310-368
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 2.61e-21
Family Classic zinc finger, C2H2 0.0054
Further Details:      
 
Domain Number 3 Region: 367-424
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 6.42e-20
Family Classic zinc finger, C2H2 0.01
Further Details:      
 
Domain Number 4 Region: 272-324
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 2.02e-17
Family Classic zinc finger, C2H2 0.0073
Further Details:      
 
Domain Number 5 Region: 493-545
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 3.51e-17
Family Classic zinc finger, C2H2 0.012
Further Details:      
 
Domain Number 6 Region: 414-445
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00000000367
Family Classic zinc finger, C2H2 0.011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSBTAP00000055347   Gene: ENSBTAG00000046243   Transcript: ENSBTAT00000065937
Sequence length 564
Comment pep:known chromosome:UMD3.1:16:64648457:64650151:-1 gene:ENSBTAG00000046243 transcript:ENSBTAT00000065937 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAQGDPQDGWGDASPLCSLTGEAYDPGMLSVNLESEDEAPGKAGDQGATGDPDQQARPRG
SSQVTEDNPDLLWKHPACRKEEKFSDSFSAAGVGKKPMAPLRKKASWERDASKITPTEAS
PRASVTPSALPRGLARKWFGETQPPRASLPAGDEADSRANLDATLGVPSNFLGSARYFRA
QKDGDKSPDNSSAGACVPKAGGSWDLSTQETHTPAQESATQACLAVEEALAKARKGSKDP
NPAGSGEGRQGEARPYKCLRGGRAVQKSLGAKPYACELCGKAYSHRATLQQHQRLHTGER
PYQCPFCDKTYTWSSDHRKHIRTHTGEKPYPCPDCGKAFVRSSDLRKHQRNMHSNDKPFP
CAECGLTFNKPLSLLRHQRTHLGEKPFRCPTCDREFAVASRMMEHQRVHSGERPFPCPTC
GKCFTKSSNLLEHQTLHTGQRPFKCADCGVAFAQPSRLARHQRIHTGERPFPCAQCGQAF
ARSSTLKRHQQIHSGEKGFLCAECGRAFRVASELAQHIRVHNGERPYQCADCGQAFTRSN
HLRRHQAKHHSCKKEPTTPSSDDE
Download sequence
Identical sequences G3N0I5
ENSBTAP00000055347 ENSBTAP00000055347 XP_002694251.1.76553 XP_589215.1.59421

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]