SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSBTAP00000055396 from Bos taurus 69_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSBTAP00000055396
Domain Number 1 Region: 262-318
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 4.76e-24
Family Classic zinc finger, C2H2 0.0062
Further Details:      
 
Domain Number 2 Region: 206-262
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.64e-23
Family Classic zinc finger, C2H2 0.0071
Further Details:      
 
Domain Number 3 Region: 758-815
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 2.64e-23
Family Classic zinc finger, C2H2 0.0074
Further Details:      
 
Domain Number 4 Region: 537-594
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 6.67e-23
Family Classic zinc finger, C2H2 0.011
Further Details:      
 
Domain Number 5 Region: 649-704
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.04e-22
Family Classic zinc finger, C2H2 0.0066
Further Details:      
 
Domain Number 6 Region: 150-206
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.56e-22
Family Classic zinc finger, C2H2 0.007
Further Details:      
 
Domain Number 7 Region: 453-509
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 8.32e-22
Family Classic zinc finger, C2H2 0.0071
Further Details:      
 
Domain Number 8 Region: 96-150
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 9.65e-22
Family Classic zinc finger, C2H2 0.0068
Further Details:      
 
Domain Number 9 Region: 37-92
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.08e-21
Family Classic zinc finger, C2H2 0.0044
Further Details:      
 
Domain Number 10 Region: 814-871
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 6.43e-20
Family Classic zinc finger, C2H2 0.01
Further Details:      
 
Domain Number 11 Region: 593-650
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.61e-19
Family Classic zinc finger, C2H2 0.0085
Further Details:      
 
Domain Number 12 Region: 1-51
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 2.4e-18
Family Classic zinc finger, C2H2 0.0055
Further Details:      
 
Domain Number 13 Region: 884-936
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 2.88e-17
Family Classic zinc finger, C2H2 0.0068
Further Details:      
 
Domain Number 14 Region: 721-772
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 4.03e-16
Family Classic zinc finger, C2H2 0.0048
Further Details:      
 
Domain Number 15 Region: 499-532
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0000000129
Family Classic zinc finger, C2H2 0.011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSBTAP00000055396   Gene: ENSBTAG00000038635   Transcript: ENSBTAT00000063817
Sequence length 940
Comment pep:known chromosome:UMD3.1:18:65105111:65135391:-1 gene:ENSBTAG00000038635 transcript:ENSBTAT00000063817 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
YDCSECGKSFSRRKYLISHRRIHTGEKPYECKECNKSFRRKGNLIEHQRVHTREKPYQCK
QCGKFFARKSIFLAHERIHTGENPYECNKCGKALTTISSFYYHLRVHTGERPYECNECGK
SFTTLSTLSNHQRVHSGERPFKCSECEKFFSRKEHLSAHMNVHTGEKPYECNKCGKSFTS
RSNLCNHWRVHIGERPFKCSECGKCFTSSSSFLRHQRVHTGERPYECSECGKSFVASSGL
RYHQRVHNGERPYECSECGKNFTARSTLRDHQRVHTGEKPYKCSECGKYFTSRSSLLRHQ
RVHTEERPYECSQCGRSFTTQTHWILNDGSPEDVGTFLLVILITNNHLQVGHSHKPQKNL
ALQLRTEARRAAELQSLALRAIKKQQQQQQQKNTKPLTEEMLGAFLGEGKIVSSHTDILV
AHERVLISEAVCEHVQVHTGEKSYKCSQCGKFFAYKSSCLAHQRVHTGERPYECPECGKS
LANRSTLSYHLRLHTGEKPFKCSECGKSFPASRSGLRYHQRVHTGERPYECSECAKSFTT
QSTLSNHQRIHSGERPFKCSACGKFFSQKVHLSTHMNVHTGEKPYECNKCGKSFTSRSKL
CTHWKVHIGERPFKCSECGKCFTSTSSLLCHQRVHNGENPYECSECGISFVGSSSLRYHQ
RVHNGEKPYECSECGKNFTARWTLRDHQRVHTGERPYKCSECGKFIAILCSIQSDLTGGT
FYDCTECGKSFSRRKYLVARRKIHTGEKPFACKECDKSFTRKGKLIEHQRVHTGEKPYQC
NQCGKFLVSKSSLSVHQRVHSGERPYKCNECGKSFITRSALYSHLKVHTGERSFECTECG
KSFTSKWILCNHQRIHSGKRPLECSECGKFFSRNEQLSAHRNVHSGENPYDCSKCGKSFP
ARSSLHHHQRVHDGEKPSECSECGKSFNDRSGLRRHQRDH
Download sequence
Identical sequences G3N0N0
ENSBTAP00000055396 ENSBTAP00000055396

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]