SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSBTAP00000055450 from Bos taurus 69_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSBTAP00000055450
Domain Number 1 Region: 59-116
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 4.91e-25
Family Classic zinc finger, C2H2 0.0031
Further Details:      
 
Domain Number 2 Region: 3-60
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.39e-24
Family Classic zinc finger, C2H2 0.0028
Further Details:      
 
Domain Number 3 Region: 228-285
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 2.03e-24
Family Classic zinc finger, C2H2 0.0055
Further Details:      
 
Domain Number 4 Region: 452-509
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 3.18e-24
Family Classic zinc finger, C2H2 0.0041
Further Details:      
 
Domain Number 5 Region: 172-229
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 3.28e-24
Family Classic zinc finger, C2H2 0.0056
Further Details:      
 
Domain Number 6 Region: 396-453
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 3.48e-23
Family Classic zinc finger, C2H2 0.0037
Further Details:      
 
Domain Number 7 Region: 508-565
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 3.54e-23
Family Classic zinc finger, C2H2 0.0044
Further Details:      
 
Domain Number 8 Region: 284-341
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 4.19e-23
Family Classic zinc finger, C2H2 0.0044
Further Details:      
 
Domain Number 9 Region: 564-621
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 6.1e-23
Family Classic zinc finger, C2H2 0.0032
Further Details:      
 
Domain Number 10 Region: 620-677
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.94e-22
Family Classic zinc finger, C2H2 0.0086
Further Details:      
 
Domain Number 11 Region: 340-397
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 2.23e-22
Family Classic zinc finger, C2H2 0.0074
Further Details:      
 
Domain Number 12 Region: 662-714
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 5.81e-21
Family Classic zinc finger, C2H2 0.0024
Further Details:      
 
Domain Number 13 Region: 115-173
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 7.56e-19
Family Classic zinc finger, C2H2 0.0049
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSBTAP00000055450   Gene: ENSBTAG00000046101   Transcript: ENSBTAT00000064558
Sequence length 721
Comment pep:known chromosome:UMD3.1:18:64014665:64032839:-1 gene:ENSBTAG00000046101 transcript:ENSBTAT00000064558 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
EKTFSKISTLTLHQRIHTGEKPYECLECRKAFSQSAHLAQHQRIHTGEKPFKCTECGKAF
SQNAHLIQHQRVHTGEKPYQCKQCNKAFSQLAYLVQHQRVHTGEKPYECIECGKAFSYCS
SLAHHRRIHTGKRPYKCIDCRKAFQQNASLIRHRRYCHTGEKPFDCIDCGKAFTDHIGLI
QHKRIHTGERPYKCNVCGKAFSHGSSLTVHQRIHTGEKPYECSICEKAFSHRGSLTLHQR
VHTGEKPYECKECSKTFSQNAHLALHQKIHTGEKPYECKECGKAFSQIAHLIQHQRVHTG
EKPYECFQCGKAFSDGSYLAQHQRLHTGKRPYACLECGKAFRQRASLICHQRCHTGEKTY
KCNICGKAFSHCKSLTLHQRIHTGEKPYQCKECGKAFGRSSSLTKHRRIHTGEKPFRCDA
CGKQFLERSSLTIHRRVHTGEKPYACGDCGKAFSQRMNLTVHQRTHTGEKPYACGDCGKA
FRKTSSLAQHERVHTGEKPFACGDCGKAFSQSMHLVVHRRTHTGEKPYACGECGRAFSQR
MHLTEHRRTHTGEKPYACGDCGRAFNKSSSLTLHRRNHTGEKPYACGECGKAFSQSSYLI
QHQRLHIGVKPFECGRCGKAFSKNSALTQHQRLHTGEKPYACPVCKKHFTGRSSLVVHQV
GHTGEKPYACGECGKAFGQSAYLIEHQRIHTGEKPYRCAQCGKAFIKNSSLTVHQRIHTG
E
Download sequence
Identical sequences G3N0T2
ENSBTAP00000055450 ENSBTAP00000055450

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]