SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSBTAP00000055462 from Bos taurus 69_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSBTAP00000055462
Domain Number 1 Region: 1-137
Classification Level Classification E-value
Superfamily SNARE-like 1.46e-28
Family Sedlin (SEDL) 0.021
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSBTAP00000055462   Gene: ENSBTAG00000047214   Transcript: ENSBTAT00000065281
Sequence length 145
Comment pep:known chromosome:UMD3.1:19:28221790:28223283:-1 gene:ENSBTAG00000047214 transcript:ENSBTAT00000065281 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MTVHNLYLFDRNGVCLHYSEWHRKKQAGIPKEEEYKLMYGMLFSIRSFVSKMSPLDMKDG
FLAFQTSRYKLHYYETPTGIKVVMNTDLGVGPIRDVLHHIYSALYVELVVKNPLCPLGQT
VQSELFRSRLDSYVRSLPFFSARAG
Download sequence
Identical sequences A0A096P2S9 A0A0D9RFA3 A0A1U7U5I9 A0A212D8W4 A0A250YA82 A0A2K5DE54 A0A2K5JNW6 A0A2K5MVT3 A0A2K5PEI0 A0A2K6ACT3 A0A2K6C1Q3 A0A2K6M7D0 A0A2K6NZP3 A0A2K6UNM8 D2HGD9 E2RTE6 F2Z5M0 F6Z280 F7AL43 F7I3W8 G1TDG9 G3QUA5 G3SLW3 G7PTJ7 H2NSL9 H2QC63 L5K010 L8IL05 L9KM79 M3YBR5 Q17QI1 Q9Y5R8 W5QAA8
ENSGGOP00000006305 ENSOCUP00000014889 ENSP00000302783 ENSDNOP00000007682 ENSCJAP00000027165 ENSCJAP00000047517 ENSCJAP00000047963 ENSTTRP00000009779 ENSFCAP00000019538 ENSOARP00000019651 ENSCHOP00000004412 ENSGGOP00000006305 ENSCJAP00000027165 ENSECAP00000009245 ENSMMUP00000029265 ENSMPUP00000008772 ENSPPYP00000008931 ENSSSCP00000028027 ENSPVAP00000015431 ENSMMUP00000029265 ENSAMEP00000003140 ENSTTRP00000009779 ENSCAFP00000024852 9544.ENSMMUP00000029265 9598.ENSPTRP00000014857 9600.ENSPPYP00000008931 9606.ENSP00000302783 9615.ENSCAFP00000024852 9796.ENSECAP00000009245 9823.ENSSSCP00000019034 9823.ENSSSCP00000019040 9986.ENSOCUP00000014889 NP_001069881.1.59421 NP_001069881.1.76553 NP_001160093.1.87134 NP_001160093.1.92137 NP_001181440.1.72884 NP_067033.1.87134 NP_067033.1.92137 XP_001111285.1.72884 XP_001172364.1.37143 XP_002719108.1.1745 XP_002827034.1.23681 XP_002921204.1.58354 XP_003416954.1.64505 XP_003810105.1.60992 XP_003996237.1.62641 XP_004012726.1.66739 XP_004058578.1.27298 XP_004266933.1.21590 XP_004398537.1.74151 XP_004433166.1.5094 XP_004458171.1.11602 XP_004684687.1.23501 XP_004760302.1.14098 XP_005220452.1.76553 XP_005582871.1.63531 XP_005582872.1.63531 XP_005597816.1.31192 XP_005657092.1.46622 XP_005894873.1.15283 XP_005959819.1.78601 XP_006062945.1.26621 XP_006151831.1.99106 XP_006193870.1.101512 XP_006863458.1.41390 XP_007091671.1.5354 XP_007126663.1.24612 XP_007166434.1.59432 XP_007457865.1.90284 XP_007950435.1.48129 XP_008008423.1.81039 XP_008060547.1.4292 XP_008541271.1.77740 XP_008574887.1.73410 XP_008686201.1.72690 XP_008853996.1.79516 XP_008994818.1.60252 XP_010338112.1.74449 XP_010360707.1.97406 XP_010841369.1.44457 XP_010964237.1.22495 XP_010994806.1.51371 XP_010994807.1.51371 XP_011385238.1.92234 XP_011726205.1.29376 XP_011813965.1.43180 XP_011849915.1.47321 XP_011907398.1.92194 XP_011977928.1.54773 XP_012312956.1.9421 XP_013969052.1.84170 XP_014645021.1.5094 XP_014717059.1.49734 XP_015452862.1.64745 XP_016010226.1.101085 XP_017387036.1.71028 XP_017650551.1.79516 XP_017705983.1.44346 XP_019269098.1.44245 XP_019521490.1.44202 XP_020031134.1.5219 XP_020031135.1.5219 XP_020724758.1.74333 XP_020923510.1.46622 XP_536628.2.84170 ENSOCUP00000014889 ENSBTAP00000055462 ENSPTRP00000014857 ENSPVAP00000015431 gi|10864021|ref|NP_067033.1| gi|262263327|ref|NP_001160093.1| ENSLAFP00000000444 ENSPPYP00000008931 ENSPTRP00000014857 ENSMPUP00000008772 ENSCAFP00000024852 GO.35148 HR27 ENSSSCP00000028027 ENSPANP00000019654 ENSECAP00000009245 ENSP00000302783 ENSP00000441130 ENSAMEP00000003140 ENSLAFP00000000444 ENSP00000302783 ENSP00000441130 ENSBTAP00000055462 ENSCHOP00000004412

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]