SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSBTAP00000055566 from Bos taurus 69_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSBTAP00000055566
Domain Number 1 Region: 283-340
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 2.04e-26
Family Classic zinc finger, C2H2 0.0044
Further Details:      
 
Domain Number 2 Region: 395-452
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.19e-25
Family Classic zinc finger, C2H2 0.0046
Further Details:      
 
Domain Number 3 Region: 339-396
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.29e-25
Family Classic zinc finger, C2H2 0.0046
Further Details:      
 
Domain Number 4 Region: 451-508
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 2.95e-25
Family Classic zinc finger, C2H2 0.0048
Further Details:      
 
Domain Number 5 Region: 245-297
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 3.13e-21
Family Classic zinc finger, C2H2 0.0031
Further Details:      
 
Domain Number 6 Region: 493-545
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 3.77e-21
Family Classic zinc finger, C2H2 0.0037
Further Details:      
 
Domain Number 7 Region: 8-69
Classification Level Classification E-value
Superfamily KRAB domain (Kruppel-associated box) 0.00000000000144
Family KRAB domain (Kruppel-associated box) 0.0069
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSBTAP00000055566   Gene: ENSBTAG00000023885   Transcript: ENSBTAT00000063058
Sequence length 552
Comment pep:known chromosome:UMD3.1:11:98174566:98189943:1 gene:ENSBTAG00000023885 transcript:ENSBTAT00000063058 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAAGLLTAGPQGSTPFSNVTVDFTQGGWRQLAPAPRDRFEEGMPENSRNLVLLGLPVSQP
GMNSQLEQREGSWMLERDGLRNACPVSPSWEVFGSTGGIAGPQETYEKAVDSVLYRSRHS
EFSSFHLSLRENCLMGNTFTRQRNSNTGHLKPAGISHKLFKVNYQNPDNPRTWQKHRRES
FQDPSVEMPSGVSEHRNSELGKSLNMRPVLSPQQRVPTEVRSHKCDTHAESFGNNAGTVK
LHRVKPYTCNECGKAFSYCSSLSQHQKSHTGEKPYECNECGKAFSQSSSLIQHQRIHTGE
KPYKCSECGRAFSQNANLTKHQRTHTGEKPYKCTECEKAFSDCSALVQHQRIHTGEKPYE
CSDCGKAFRHSANLTNHQRTHTGEKPYKCRECGKAFSYCAAFIQHQRIHTGEKPYKCNAC
GKAFSQSANLTNHQRTHTGEKPYKCSECGKAFSQSTNLIIHQKTHTGEKPYKCNDCGKFF
SESSALIRHHIIHTGEKPYECNECGKAFNQSSSLSQHQRIHTGVKPYECRECGKAFRCSS
AFIRHQRLHAGE
Download sequence
Identical sequences G3N141
ENSBTAP00000055566 ENSBTAP00000055566

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]