SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSBTAP00000055624 from Bos taurus 69_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSBTAP00000055624
Domain Number 1 Region: 8-119
Classification Level Classification E-value
Superfamily EF-hand 4.26e-29
Family EF-hand modules in multidomain proteins 0.0045
Further Details:      
 
Domain Number 2 Region: 122-221
Classification Level Classification E-value
Superfamily EF-hand 7.89e-25
Family EF-hand modules in multidomain proteins 0.0021
Further Details:      
 
Domain Number 3 Region: 203-280
Classification Level Classification E-value
Superfamily RING/U-box 4.47e-18
Family ZZ domain 0.0088
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSBTAP00000055624   Gene: ENSBTAG00000046454   Transcript: ENSBTAT00000065729
Sequence length 670
Comment pep:known chromosome:UMD3.1:2:95376524:95431378:-1 gene:ENSBTAG00000046454 transcript:ENSBTAT00000065729 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
LLPGRKDALNSIENSTYRTAFKLRSVQTLCQLDLIGSSLIQHVLRHQSLWEAGESTLSVQ
QLFQALQEMFQKVRVEKPGQMHPRASELTLSLLTTMYDSTGTGFIKLAPAAAALITLSGD
SPLTKYTALFQLYAENNRGGHDLGARMTRRVLRNLLTDLQQIPTVVGESRALCSVESATR
SCFQGVLSPVIKEEKFLSWLQSEPPILLWIPTCYRLSATEMATHPVRCRICRNFPITGLR
YRCLKCLNFDICQACFLSSFQGESHQKSHPVVENCIQMSAKDDTRLVLRTPRNNLLQGRC
RRKEASRRQWLLDKVNPKDMASHAQASRLSIQCNRSEVPMYERTTEPVETPATETFKQMP
QRLSRAQQTNGSNPHHQTIFSVRNELWRTHKSINALHRDRRLLKKRLNRYKDKLQAIYAC
QEEKSCRYDTKIHELTINQDSLGTKLQLMGQDLQAMLQPLHRSSFSWQNVIAKGDHGRGE
ERFQKRGGDSSQIKGSTEDGSQQETLPRSTVINGSHRGPAPAKHALPNSELPEATSKPRP
VQSPRAQSRAQKTSKETSSALPSSQEGRLQDIPQIPPIEMTSLALAPVERKGAMNIQEGK
DELEEEELQELLSKLTDACTLEAPSDLQSSVNLDLYCGAERVCRAFSALVDQITLTNLKE
HQKNLAAPLV
Download sequence
Identical sequences G5E6I8
ENSBTAP00000055624 ENSBTAP00000055624

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]