SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSBTAP00000055874 from Bos taurus 69_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSBTAP00000055874
Domain Number 1 Region: 46-135
Classification Level Classification E-value
Superfamily Retrovirus capsid dimerization domain-like 5.04e-38
Family SCAN domain 0.0000629
Further Details:      
 
Domain Number 2 Region: 533-589
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 2.57e-26
Family Classic zinc finger, C2H2 0.0045
Further Details:      
 
Domain Number 3 Region: 644-701
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.74e-23
Family Classic zinc finger, C2H2 0.0051
Further Details:      
 
Domain Number 4 Region: 476-533
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 5.44e-23
Family Classic zinc finger, C2H2 0.0038
Further Details:      
 
Domain Number 5 Region: 588-645
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 6.92e-22
Family Classic zinc finger, C2H2 0.0047
Further Details:      
 
Domain Number 6 Region: 686-738
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 6.09e-18
Family Classic zinc finger, C2H2 0.0047
Further Details:      
 
Domain Number 7 Region: 167-224
Classification Level Classification E-value
Superfamily KRAB domain (Kruppel-associated box) 2.48e-17
Family KRAB domain (Kruppel-associated box) 0.0017
Further Details:      
 
Domain Number 8 Region: 441-490
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 7.3e-17
Family Classic zinc finger, C2H2 0.0073
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSBTAP00000055874   Gene: ENSBTAG00000012390   Transcript: ENSBTAT00000063627
Sequence length 745
Comment pep:known chromosome:UMD3.1:8:102637677:102649996:1 gene:ENSBTAG00000012390 transcript:ENSBTAT00000063627 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
TASRSSLNKMTAVSPDPHTLVSSEQSKVLRMETPGTPESLMRRDTADPESFRQRFRWFCY
SEEAGPRKTLNQLWELCVQWLRPDIHTKDQILELLVFEQFLTILPGEIRIWVKSQHPKSS
EEVVTLVEDLTQVLEEKKEPVSQDSVISQEENPEEDKTVSVLPNTESQESMTLKDVAVTF
SRGEWRKLEPSQKEIYKEVLLENYKNLELLGFPVSKLDLVSQLKWAGLPRLLQKEVSKGC
RPEESTLDKIIERYLMSGDCDSMGESWKRYGRFEDGCSNREHSQGQITQKKTHGRGSKGE
EFDPERSPFGSSFKPPSDLIKHLRVYLRKKSRRYNEGKKPFSFHSDLVPNRKEHSGEKPR
KGNEGRKVLSHSSSRTEHQKHQKSRGGEKSQKCSNCGVAFTRSSSLSKKNSSTCEKCWKG
LGQGASIDKDEGTETGEGTRKCSKCGKAFGYSASLTKHRRIHTGEKPYLCNDCGKAFSDS
SSLTPHHRTHSGEKPFKCDDCGKSFTLSAHLIKHQRVHTGEKPYKCKDCGRPFSDSSSLI
QHQRIHTGEKPYTCNNCGKSFSHSSSLSKHQRIHTGEKPYKCGECGKAFRQNSCLTRHQR
IHTGEKPYLCNDCGMTFSHFTSVIYHQRLHSGEKPYKCTQCEKAFPTHSLLSRHQRIHTG
VKPYKCKDCGKSFSQSSSLNEHHRIHTGEKPYECNYCGATFSRSSILVEHLKIHTGRREY
ECNECEKTFKSNSGLIRHRGFHSSE
Download sequence
Identical sequences G3N1X0
ENSBTAP00000055874 ENSBTAP00000055874

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]