SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSBTAP00000055880 from Bos taurus 69_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSBTAP00000055880
Domain Number 1 Region: 296-352
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.81e-20
Family Classic zinc finger, C2H2 0.012
Further Details:      
 
Domain Number 2 Region: 352-408
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 2.19e-20
Family Classic zinc finger, C2H2 0.0079
Further Details:      
 
Domain Number 3 Region: 397-449
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 2.76e-19
Family Classic zinc finger, C2H2 0.0047
Further Details:      
 
Domain Number 4 Region: 253-305
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 2.5e-18
Family Classic zinc finger, C2H2 0.0052
Further Details:      
 
Domain Number 5 Region: 226-262
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.000000000122
Family Classic zinc finger, C2H2 0.01
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSBTAP00000055880   Gene: ENSBTAG00000045531   Transcript: ENSBTAT00000064846
Sequence length 454
Comment pep:known chromosome:UMD3.1:27:16848690:16850282:-1 gene:ENSBTAG00000045531 transcript:ENSBTAT00000064846 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSENDEEEISQQEGTGDYEVEEIAFGLEPQSPGFGPQSPEFEPQSPRFEPESPGFESRSP
GFVPPSPEFAPRSPESDSQSPDFEPQSPRYEPQSPGYEPKSPGYEPRSPGYGTQSPEYEP
QNPEFKTQSPEFEAESSKFQEGAEMLLNPEEKNPLSIPLGVHPLDAFTQGFGEQPAGGMP
LGPPFEMPTGALLAPPQFEMLQNPLGLTGTLRGPGRRGGRARGGQGPRPNICGICGKSFG
RGSTLIQHQRRTHSGQKPYKCPHCGKAFGDSSYLLRHQRTHSHERPYSCPECGKCYSQNS
SLRSHQRVHNGQRPFSCGICGKSFSQRSALIPHARSHAREKPFKCPECGKRFGQSSVLAI
HARTHLPGRTYSCPDCGKTFNRSSTLIQHQRSHTGERPYRCAVCGKGFCRSSTLLQHHRV
HSGERPYKCDDCGKAFSQSSDLIRHQRTHAAGWR
Download sequence
Identical sequences G3N1X6
ENSBTAP00000055880 ENSBTAP00000055880

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]