SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSBTAP00000055902 from Bos taurus 69_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSBTAP00000055902
Domain Number 1 Region: 499-555
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 2.8e-18
Family Classic zinc finger, C2H2 0.011
Further Details:      
 
Domain Number 2 Region: 204-256
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 4.84e-18
Family Classic zinc finger, C2H2 0.0052
Further Details:      
 
Domain Number 3 Region: 300-356
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 6.44e-17
Family Classic zinc finger, C2H2 0.01
Further Details:      
 
Domain Number 4 Region: 356-412
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00000000000000168
Family Classic zinc finger, C2H2 0.018
Further Details:      
 
Domain Number 5 Region: 242-300
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0000000000000209
Family Classic zinc finger, C2H2 0.011
Further Details:      
 
Domain Number 6 Region: 459-508
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0000000000591
Family Classic zinc finger, C2H2 0.011
Further Details:      
 
Domain Number 7 Region: 429-472
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.000000000849
Family Classic zinc finger, C2H2 0.027
Further Details:      
 
Domain Number 8 Region: 113-170
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00000000127
Family Classic zinc finger, C2H2 0.025
Further Details:      
 
Domain Number 9 Region: 77-124
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.000057
Family Classic zinc finger, C2H2 0.038
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSBTAP00000055902   Gene: ENSBTAG00000045572   Transcript: ENSBTAT00000063509
Sequence length 586
Comment pep:known chromosome:UMD3.1:18:25984798:25986558:-1 gene:ENSBTAG00000045572 transcript:ENSBTAT00000063509 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSESWQQPPQTQPQQPQPPQPQHHAEPPPALAEHTLPPGTAENPLGCAVYGILLQPEPGL
QPPQHVPLQAAGEPGPKCGVCGHDLAHLSSPHEHQCLAGHDRSFQCTQCLKIFHQATDLL
EHQCVQAEQKPFVCGVCKMGFSLLTSLAQHHSAHSGTGGLVKCSICEKTYKPAEAAEPEA
TAAPSLPPAPPPPPAVAPAESADKPYSCPICQKPFKHLSELSRHERIHTGEKPYKCTLCD
KSFSQSSHLVHHKRTHSSERPYKCAVCEKTFKHRSHLVRHMYAHSGEHHLFRCNVCELHF
KESSELLQHPCTPSGERPFRCGECQKAFKRPSDLRQHERTHSAERPFKCDLCPMGFKQQY
ALMRHRRTHKAEEPFKCGLCEKGFGQPSHLLYHQHVHTLETLFKCPVCQKGFDQSAELLR
HKCLPGAAERPFKCPVCHKAYKRASALQKHQLAHCSAAEKPLRCTLCERRFFSSSEFVQH
RCDPAREKPLKCPDCDKRFKYASDLQRHRRVHTGEKPYKCPNCDKAFKQREHLNKHQGVH
AREQQFKCVWCGERFLDVALLQEHSAQHSAAAAAAEGAYQVAACLP
Download sequence
Identical sequences G3N1Z7
ENSBTAP00000055902 ENSBTAP00000055902 XP_005195277.1.59421 XP_005218873.1.76553 XP_010812936.1.76553 XP_010821866.1.59421 XP_017917546.1.57651

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]