SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSBTAP00000056003 from Bos taurus 69_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSBTAP00000056003
Domain Number 1 Region: 8-69
Classification Level Classification E-value
Superfamily KRAB domain (Kruppel-associated box) 2.35e-23
Family KRAB domain (Kruppel-associated box) 0.0013
Further Details:      
 
Domain Number 2 Region: 211-268
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 2.35e-20
Family Classic zinc finger, C2H2 0.0062
Further Details:      
 
Domain Number 3 Region: 253-305
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 2.31e-18
Family Classic zinc finger, C2H2 0.0046
Further Details:      
 
Domain Number 4 Region: 171-221
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00000000000000258
Family Classic zinc finger, C2H2 0.0076
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSBTAP00000056003   Gene: ENSBTAG00000046866   Transcript: ENSBTAT00000063252
Sequence length 309
Comment pep:known chromosome:UMD3.1:14:2281340:2284499:1 gene:ENSBTAG00000046866 transcript:ENSBTAT00000063252 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAGSPPAAWPQGLLTFGDVAVHFTQEEGARLDAGQRTLYRDVMLETYRNLVSLGVPESKP
DLISQLEQGREPWGSDLLGAQEAETSGNAGMAQPNQPELGGGSWLKGGTCLQPGLEVQTS
GCWQAELSELSAAAGQECQGGGGLVYGACSVSYRLQLEKGGKKNRETNAKGQAAHRCETC
AKTFRYLSRLVRHRATHSGEKPHACGECGRAFSQRSHLAQHRSAHAGQKPHTCGQCGRAF
TRLSTLHRHQRVHSGEKPFGCQWCGKPFSYSTLLAQHQRIHTRERPFRCSKCGKSFIWKS
SFRTHQKSH
Download sequence
Identical sequences G3N293
ENSBTAP00000056003 ENSBTAP00000056003

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]