SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSBTAP00000056042 from Bos taurus 69_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSBTAP00000056042
Domain Number 1 Region: 2905-2950
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0000000844
Family Classic zinc finger, C2H2 0.021
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSBTAP00000056042   Gene: ENSBTAG00000045507   Transcript: ENSBTAT00000063301
Sequence length 3510
Comment pep:known chromosome:UMD3.1:18:13740622:13753849:1 gene:ENSBTAG00000045507 transcript:ENSBTAT00000063301 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MPGEQPLGTPPPTMTGDLQPCPAASGTGGPLRPPGEISALANRTTKAMGSRAQATDDPKA
QVQQAGKGLTEAPLPRAQALSSVPSKGSSPQTPAGSNLMQARVRRAGRVAGSPQQLYSLN
IASTRPKPALDGKTPESLQPEDLRPLNAEAPPSQGTRAGLRPGHPRAEASPAPEELSFQK
CFQETPSSFTSTNYTSPSATPGPPPLRAPQSRGTSPCRPASYLEFQASGADAWPPPAENS
FPGASFGVPPTEPEPFPEGGSPGVAAFQYPFPELHGAGRRPFPEDTAGPKYPERALVLAF
HQPRGAWPEAVGTGPVYPLAARPARPPPPCYSSRPGSLEAPSDLGGVPPPPSAAPPAPKP
FSDGLHENMTKVLPERPPSAHEGLGSPRGPPNSLSQRQFPGQAYGSPGASGVGTSPGPRD
TELAASGPPTARLPPLWDPAPAPYPPPPLGPPATTFFEAQPSPGQQLSLPQSPPLPWPQV
LPATGPSPHQMEMLNRLPFPPGAPEWQGGSQGALGAVGKTPGPGEKLAVLRNSPGQHGSG
SPGLFAYNGLKDPGAQPLFFGAAQPQASPRGPPGLPPPRVVGASPSESPLPSPATHTASS
TCSSLSPLSSSPANPSSDESQVPGPLVPSAFFHPAPHPQEAGSPFPSPEPSHSLPIHYQP
EPAKTFPFPTEGLEETPFQGLEETPFPSSGLQVLRAGLEGFPQGPPPYSTHHFPLSSASL
DQLDVLLTCRQCDRNYSSLAAFLGHRQFCGLLPARAQDSHQQPPGLPAPPRVPAGRTPSP
LSHARTAPFLLGGDLRPDGRDDPLRTSFLPGPTATPFPLPTGDLDLEDAAKLDSLITEAL
NGLEYQSDNPEIDSSFIDVFTDEEPSGPKGSAAGQPPKARLGATPENKAPAPALPPAVDV
PLETQPRQPGDGGNPAGPRPKTRSLGPAPAETDGASLAGQQRRGKRFKLFRKELDTVNTT
KRPGRGSRATRLRPRRKGRAEARPRDLRTQAPKSHTDPGGRAPLVETRSSRRLRLSPGQD
CRRRRARGGTWSKELIHKIVQQKNRAGGRGPAPGAADGGPQHCDCAASESEEEDGPRPPG
SRFRGRPRPSGRRWRRGEKRKEVDLTPGVREDGQQQKPRKVVKQEAARSRGYLGPEEPGR
PGPGPSQSPGAQGPSHGPEAGVDLEEKGPQHLLRDLIGTKTVEESHPPPGFPQDTETPEV
ADGLPPDATELHKEAPGSSPAPCRGGGPCPSAPELPQLHGEDAGLPLASSPTLGARRCLE
PVASQDREDPPASPSGESLVPVANAVHMVHLDPSTLFVKTPGLGESIEAPAARKGPKPYS
SPHSELFLGPKDLASCFHEDLGSRASAPDSPLAIRAHLCQDNHDASSPEPKPPRSPPYTG
ITDPGRGQSALALEPTPLPLGLPRDNFDPPPYGSLSGRGDTPALRACAALPPRKPQLDPP
YPSFLPERDWSLLEEVSPVPPGHPGLFPGLSAEKTLSQQCPSEGPVAASLSALPTRAVEC
STASTSDLSEEELEIKRLVTELESQLQSRGPQGARGEPCRASNTAPRDSSSHGKGVDTRG
DALASPQEEWPSPLAPSTHKDMVPQGPSSPMGASLSFQSVQKARVPKTRLPRAEGGQRAR
QEVCVPDPMSDVGSLAKCSPSLEPSLPKGHGAPGTQHSQGLPLLLPHPPRGGVSPGPHKA
PGPCQDPLELEAFSSPTTHLAPGLAYRGAELLPLGTTPPSAAIHSSAPRGHSVSSTGEPG
GTELLPAVTAGPVPEGKEEFVPVGVSPSCASIPNPSPGGRLQNPASSPLHQLQLLVARAA
ERGDDARGSRVTPTAEAQSPLHSNPSDVGGDGKEGETVAHSPALGSLGDVQMTTVARHQL
EPDEDGHVGTLGQARKPRGQAEAGHLQPGDQGRPGGPDSCTTASADPETTPAGLVGAADQ
LGAQLQGSRAAMGLCNKAQATPSPTSSEADSSVPALVAAHTPDRPRDWTLEAXRGAMWPD
PHTCQEGKALASLQGQESLETPGARLPAITKASEAGARGVPVMCPPTELCPGSTTSDSRA
LFPQCALHQRPQADALSPQDLRQKPRGFKKKPVFTENGHWRGGAPSGRPVTCEVCSASFR
SGPGLSRHRARKHGLHKGATSQPSPAPQPAPQMCHRPGKKSRRALGKEEAGRLVGDPSQA
GEPPPVCGSTPLLGAPGCPPSWEPHTPDTIRQGVDVKPAEPRKQDRLGREELRPKQAEKG
GGQRRGRPHTDFPSESEGKSNKKARKPRARRFREESNPQAPANVTPDRSCWSPSTSAANC
CRLSPKTEQETKATQLSPAAMDLEETPAQKPPGDWVACSRMVEGAPPGEGPGEQKAALAG
GCGGPRETRTSGICEEPLRVTGAKPAGDSREADSRLGHSVLEEHGLPRGPPETRGSEAGG
TISSPCSQAPLHSPAEGVPEQEGTAPKPPSPERGDPLSLLDDEASFSQLFPLGDRLARKK
NPRVYGKRCKKSKPPPRVEPSGQVGGSVTLPSARLPTDLSDSGSLCLSHEDPWGDEATDL
PESFLLEGFLNSKVPGIDPWAPGPSLWALEPHLETKPCRAEDHPSENIPKLHMVPAAWRG
LELQAPEDEVTSSLGDASPEPPNLEREHYDGGVPRSAADLEMLGTKLELQDLSFLGPCED
PVGLPSTSFLDVKATAGSQGPRSRTEEADGARKAAGEGQHAKARRASYKCRVCFQRFHGL
GELDLHKLAHSPSPPPTCYMCVERRFGSRELLREHLLEKHVQSKAGLWACGMCLREVADV
WMYNEHLREHAVRFARKGQARRSLEDLPACWEGGGVVTHFLSGIAGQASRSHRGKRSVAG
KVGGGCAESSGPNAGARKALPRERPRPQARSRGCDAVGASAQGSPSACARPAPAGGASPE
AHPHGEPPLPAVPVHQDCKDPARDCHHCGKRFPKPFKLQRHLAVHSPQRVYLCPQCPRVY
PEHQELRAHLGSEHGVSGELELAHTPLYACELCANVTHISKRSFVCSSCNYTFAKKEQFD
RHMDKHRRKGQQPFTFRGVRRPGAPGRKASAREGTLPSKRRRVAAPGSPARSSTDGPLSQ
GSSPTPSEGSLPALLQPCPEAAPSVTAGQPGTPERPIDPLGHQELLPPSLSPFPAASAGG
KDGHKPDQALESSEDEASPGSPEHLLQKAFPLGGSLPRLGAADHEVEEKRAAGPLSGKGK
CAPDHHPEAPSLLWKEKQVSTCLLVPAGATGGPSHRGSAPKPRGCGSLSKDRSSSSTPNK
APKIPGQLKKAVASPVPGELPRGTEERLKPTALKAKPGFQGAGGPRQGTKAVGGSQPQPA
SGRLQSETATTPAKPDCPGQGPAPDKALPRALAKGYPKGPREAGGQGLRGSLGPREDADS
SEKKRKGRAPEPARSEGVGSLGKGPSAPDKPPRAPRKQATPSRVIPAKPKPKPKSSSQNS
SMLPQPSEVQKREPSHAHGDLRCSKEGLSKALPQTRPLHRPPRKGGALHSAEPPNPRACR
TAESQSHLLSQLFGQRLTSFKIPLKKDSSE
Download sequence
Identical sequences G3N2D0
ENSBTAP00000056042 ENSBTAP00000056042

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]