SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSBTAP00000056080 from Bos taurus 69_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSBTAP00000056080
Domain Number 1 Region: 108-165
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 7.78e-28
Family Classic zinc finger, C2H2 0.0029
Further Details:      
 
Domain Number 2 Region: 647-704
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 5.85e-27
Family Classic zinc finger, C2H2 0.0031
Further Details:      
 
Domain Number 3 Region: 423-480
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 6.36e-27
Family Classic zinc finger, C2H2 0.0039
Further Details:      
 
Domain Number 4 Region: 164-221
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.67e-26
Family Classic zinc finger, C2H2 0.0032
Further Details:      
 
Domain Number 5 Region: 311-368
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 2.1e-26
Family Classic zinc finger, C2H2 0.0034
Further Details:      
 
Domain Number 6 Region: 535-592
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 8.52e-26
Family Classic zinc finger, C2H2 0.0031
Further Details:      
 
Domain Number 7 Region: 479-536
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 2.61e-25
Family Classic zinc finger, C2H2 0.0033
Further Details:      
 
Domain Number 8 Region: 367-424
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 2.68e-25
Family Classic zinc finger, C2H2 0.0057
Further Details:      
 
Domain Number 9 Region: 591-648
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.1e-23
Family Classic zinc finger, C2H2 0.0043
Further Details:      
 
Domain Number 10 Region: 52-109
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 3.29e-23
Family Classic zinc finger, C2H2 0.0046
Further Details:      
 
Domain Number 11 Region: 703-758
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.8e-22
Family Classic zinc finger, C2H2 0.0037
Further Details:      
 
Domain Number 12 Region: 14-66
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 2.06e-20
Family Classic zinc finger, C2H2 0.0052
Further Details:      
 
Domain Number 13 Region: 273-325
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 6.91e-20
Family Classic zinc finger, C2H2 0.0054
Further Details:      
 
Domain Number 14 Region: 206-258
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.54e-19
Family Classic zinc finger, C2H2 0.0034
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSBTAP00000056080   Gene: ENSBTAG00000010252   Transcript: ENSBTAT00000065936
Sequence length 759
Comment pep:known chromosome:UMD3.1:24:22051908:22095721:-1 gene:ENSBTAG00000010252 transcript:ENSBTAT00000065936 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
TNSVTYQKVPTEERPYRCDICGHSFKQHSSLTQHQRIHTGEKPYKCNQCGKAFSLRSYLI
IHQRIHSGEKAYECSECGKAFNQSSALIRHRKIHTGEKACKCNECGKAFSQSSYLIIHQR
IHTGEKPYECNECGKTFSQSSKLIRHQRIHTGERPYECNECGKAFRQSSELITHQRIHSG
EKPYECNECGKAFSLSSNLIRHQRIHSGEEPYQCNECGKTFKRSSALVQHQRIHSGEEAY
ICSECGKAFRHRSVLTRHQRVHTVKHRRTHWEKPYECDQCGKAFNVSSALVLHQRIHTGE
KPYPCNWCIKSFSRSSDLIKHQRVHTGEKPYKCDECGKAFSQSSDLIIHQRIHTGEKPYQ
CGHCSKSFSQRSDLIKHQRIHTGEKPYTCSLCNKHFSQSSDVIKHQRIHTGEKPYKCDVC
GKAFSQSSDLILHQRIHTGEKPYRCNQCNKSFSQNSDLIKHRRIHTGEKPYKCNECGKAF
NQSSVLILHQRIHTGEKPYPCNQCSKTFSRLSDLINHQRIHTGEKPYPCNQCSKTFSRRS
DLIKHYRIHTGEKPYECDECGKTFSQSSNLILHQRIHTGEKPYPCSDCTKSFSRRSDLVK
HQRIHTGEKPYTCNQCNKSFSQSSDLIKHQRVHSGEKPYHCDCCERAFSQSSDLILHQRI
HTGEKPYACTQCSKSFSQNSDLIKHQRIHTGEKPYKCNECGKAFSQCSALVLHQRIHTGE
KPYPCGQCGKGFSRRSDLINHQRIHTNENPYKCDNVGKT
Download sequence
Identical sequences G3N2G8
ENSBTAP00000056080 ENSBTAP00000056080

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]