SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSBTAP00000056088 from Bos taurus 69_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSBTAP00000056088
Domain Number 1 Region: 4-90
Classification Level Classification E-value
Superfamily EF-hand 3.49e-22
Family S100 proteins 0.00098
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSBTAP00000056088   Gene: ENSBTAG00000012638   Transcript: ENSBTAT00000063314
Sequence length 94
Comment pep:known chromosome:UMD3.1:3:17163820:17165144:1 gene:ENSBTAG00000012638 transcript:ENSBTAT00000063314 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
FGKMTKLEDHLEGIINIFHQYSVRVGHFDTLNKRELKQLITKELPKTLQQNTKDQPTIDK
IFQDLDADKDGAVSFEEFVVLVSRVLKTAHIDIH
Download sequence
Identical sequences G3N2H5
ENSBTAP00000056088 ENSBTAP00000056088

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]