SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSBTAP00000056103 from Bos taurus 69_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSBTAP00000056103
Domain Number 1 Region: 55-112
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0000000000214
Family BED zinc finger 0.049
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSBTAP00000056103   Gene: ENSBTAG00000046637   Transcript: ENSBTAT00000063209
Sequence length 218
Comment pep:known chromosome:UMD3.1:1:56759266:56759922:-1 gene:ENSBTAG00000046637 transcript:ENSBTAT00000063209 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
RMRREEEEEDGNRMKAKGRLEVKEEEEISEAGEPVAPFVGATPTPMPHNKGTRFSEAWEY
FHLAPARAGHHPNQYATCRLCGRQVSRGPGVNVGTTALWKHLKSMHKDELEKSGHGQAGQ
RQDPRPQGSQLPTGIEGDWARLLEQMGALALWASQREKELLRRERAVEWRERAVERRERA
LEEVERAILEMRRKVRAEKEACQREKDQSGAAHPFHFV
Download sequence
Identical sequences G3N2I8
ENSBTAP00000056103 ENSBTAP00000056103

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]