SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSBTAP00000056125 from Bos taurus 69_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSBTAP00000056125
Domain Number 1 Region: 57-296
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 1.29e-56
Family G proteins 0.0013
Further Details:      
 
Domain Number 2 Region: 277-357
Classification Level Classification E-value
Superfamily TGS-like 3.71e-18
Family G domain-linked domain 0.014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSBTAP00000056125   Gene: ENSBTAG00000008257   Transcript: ENSBTAT00000010867
Sequence length 358
Comment pep:known chromosome:UMD3.1:14:59100801:59101904:1 gene:ENSBTAG00000008257 transcript:ENSBTAT00000010867 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSNTLAKIAEIEAEMARTQKNKATAHHLGLLKAHLAKLRSGGGPGEGFDVAKTGDARIGF
VGFPSVGKSTLLSNLAGVYSEVAAYEFTTMTTVPGVIRYKCAKIQLLDLPGIIEGAKDGK
GRGRQVIAVARTCNLILIVLDVLKPLGHKKIIENELEGFGIRLNSKPPNIGFKKKDKGGI
NLTATCPQSELDAETVKSILSEYKIHNADVTLRSDTTADDLIDVVEGNRVYIPCICVLNK
IDQISIEELDIIYKVPHCVPISAHHRWNFDDLLEKIWDYLKLVRIYTKPKGQLPDYMSPV
VLPYSRTTVEDFCMKIHKNLIKEFKYALVWGLSVKHSPQKVGKDHTLEDEDVIQIVKK
Download sequence
Identical sequences G3N2L0
ENSBTAP00000056125 ENSBTAP00000056125

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]