SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSBTAP00000056153 from Bos taurus 69_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSBTAP00000056153
Domain Number 1 Region: 502-559
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 6.85e-27
Family Classic zinc finger, C2H2 0.0039
Further Details:      
 
Domain Number 2 Region: 418-475
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 2.91e-26
Family Classic zinc finger, C2H2 0.0058
Further Details:      
 
Domain Number 3 Region: 670-727
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 3.43e-25
Family Classic zinc finger, C2H2 0.0043
Further Details:      
 
Domain Number 4 Region: 362-419
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 7.29e-25
Family Classic zinc finger, C2H2 0.0052
Further Details:      
 
Domain Number 5 Region: 280-333
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 9.84e-23
Family Classic zinc finger, C2H2 0.006
Further Details:      
 
Domain Number 6 Region: 558-615
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.11e-22
Family Classic zinc finger, C2H2 0.0058
Further Details:      
 
Domain Number 7 Region: 11-72
Classification Level Classification E-value
Superfamily KRAB domain (Kruppel-associated box) 1.31e-21
Family KRAB domain (Kruppel-associated box) 0.00089
Further Details:      
 
Domain Number 8 Region: 614-671
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.73e-21
Family Classic zinc finger, C2H2 0.0056
Further Details:      
 
Domain Number 9 Region: 726-777
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 5.33e-18
Family Classic zinc finger, C2H2 0.0046
Further Details:      
 
Domain Number 10 Region: 465-497
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0000000000705
Family Classic zinc finger, C2H2 0.0059
Further Details:      
 
Domain Number 11 Region: 323-354
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00000000585
Family Classic zinc finger, C2H2 0.0071
Further Details:      
 
Domain Number 12 Region: 246-292
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0000000142
Family Classic zinc finger, C2H2 0.0073
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSBTAP00000056153   Gene: ENSBTAG00000045868   Transcript: ENSBTAT00000063491
Sequence length 778
Comment pep:known chromosome:UMD3.1:8:103982264:104010320:-1 gene:ENSBTAG00000045868 transcript:ENSBTAT00000063491 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAVSGPGGSAAGSVTFNDVTMAFTRKEWEQLDPAQKSLYKDVMLENYSNLASMGVGYQAL
KPDMISKLEKGEEPWLGKGKGSRQGGSSEIARTKEIGANGTLIMCSARPDSPSIILPLCQ
NFTLEEVHQDDDQLKNHQKSQNKILRGVAFKKTTLTKKKSHERSSLQKKNVSTKYIPSKK
KLLKFDSHAKEHRKSFNHSLSDTKKDKNQIGKKCEKSSTYSSSNGPDKTQTDKKYTEQDK
IQTGEEHEKSSSHCSSLTKHEKTQNKVKPYECNECGKVLSHKQGLVDHQRIHTGEKPYEC
NECGIAFSQKSHLVVHQRTHTGEKPYECVQCGKAHGHKHALTDHLRVHTGEKPYECTDCG
KTFRHSSNLMQHVRSHTGEKPYECKECGKSFRYNSSLTEHVRTHTGEIPYECNECGKAFK
YSSSLTKHMRIHTGEKPFECNECGKAFSKKSHLIIHQRTHTKEKPYKCNECGKAFGHSSS
LTYHMRTHTGESPFECNQCGKAFKQIEGLTQHQRVHTGEKPYECNECGKAFSQKSHLIVH
QRTHTGEKPYECNECGKAFNAKSQLVIHQRSHTGEKPYECNECGKAFNHISTLTQHQRIH
TVKKPYACVKCGKAFSQGTHLIEHQRIHPGEKLYKCNECGKTFSHNPAFIQHQKIHAGEK
PYECNERGKAFSPSTNLIQHQKVHTREKPYECNECEKAFSHSSSLIWHQRIHTGEKPYEC
NECGKAFNRSAHLTEHQRTHTGKKPYVCKECGRTFSRSTYLTEHLKLHSGEKSYQCNG
Download sequence
Identical sequences G3N2N6
ENSBTAP00000056153 ENSBTAP00000056153

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]