SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSBTAP00000056205 from Bos taurus 69_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSBTAP00000056205
Domain Number 1 Region: 11-128
Classification Level Classification E-value
Superfamily POZ domain 8.24e-27
Family BTB/POZ domain 0.0011
Further Details:      
 
Domain Number 2 Region: 421-477
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 2.08e-23
Family Classic zinc finger, C2H2 0.0077
Further Details:      
 
Domain Number 3 Region: 304-359
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.12e-20
Family Classic zinc finger, C2H2 0.0085
Further Details:      
 
Domain Number 4 Region: 462-514
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.47e-16
Family Classic zinc finger, C2H2 0.0083
Further Details:      
 
Domain Number 5 Region: 346-398
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 4.86e-16
Family Classic zinc finger, C2H2 0.012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSBTAP00000056205   Gene: ENSBTAG00000010113   Transcript: ENSBTAT00000064541
Sequence length 680
Comment pep:known chromosome:UMD3.1:9:41168310:41176125:1 gene:ENSBTAG00000010113 transcript:ENSBTAT00000064541 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAETSSEPSGQLVVHSDTHSDTVLASFEDQRKKGFLCDITLIVENVHFRAHKALLAASSE
YFSMMFAEEGEIGQSIYMLEGMVADTFGILLEFIYTGCLQASEKSTEQILATAQFLKVYD
LVKAYTDFQNNHSSPKPPTLNTAGAPLVVISNKKSDHPKRKRGRPRKVNSLQEGKSELAA
EEEIQLRVNNSVQNRQNFVVKEGDSGVLNEQITAKELEESEPTCEPARGEEMPVEKDENC
DPKTQDSGQDSQSRCSKRRIRRSVKLKDYKLVGDEDDQGSAKRVCGRRKRPGGPEARCKD
CGKVFKYNHFLAIHQRSHTGERPFKCNECGKGFAQKHSLQVHTRMHTGERPYTCTVCSKA
LTTKHSLLEHMSLHSGQKSFTCDQCGKYFSQKRQLKSHYRVHTVLRQGHSLPECNDCHRK
FMDVSQLKKHLRTHTGEKPFTCEICGKSFTAKSSLQTHIRIHRGEKPYSCAVCGKSFSDS
SAKRRHCILHTGKKPFTCPECNLQFARLDNLKAHLKIHSKEKHASDASSISGNNNGEEVR
NILQLQPYQLSSPSQGISIVTAESSQNMTADQTANLTLLTQQPEQLQNLILSAQQEQTEH
IQSLNMIESQMEPSQTEPVHVITLSKETLEHLHAHQEQTGELHLASASDPAQHLQLTQEP
APPPATHHVPQPTSLSQEQS
Download sequence
Identical sequences G3N2T5
ENSBTAP00000056205 ENSBTAP00000056205

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]