SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSBTAP00000056239 from Bos taurus 69_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSBTAP00000056239
Domain Number 1 Region: 65-179
Classification Level Classification E-value
Superfamily Frizzled cysteine-rich domain 5.23e-42
Family Frizzled cysteine-rich domain 0.00000794
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSBTAP00000056239   Gene: ENSBTAG00000020590   Transcript: ENSBTAT00000027434
Sequence length 592
Comment pep:known chromosome:UMD3.1:19:44954982:44956760:1 gene:ENSBTAG00000020590 transcript:ENSBTAT00000027434 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
RRGRRAVSGLGAGAGGRPGAEWGAAASMRPRSALPRLLLPLLLLPAAGPAQFHGEKGISI
PDHGFCQPISIPLCTDIAYNQTIMPNLLGHTNQEDAGLEVHQFYPLVKVQCSPELRFFLC
SMYAPVCTVLEQAIPPCRSICERARQGCEALMNKFGFQWPERLRCEHFPRHGAEQICVGQ
NHSEDGAPALLTTAPPPGLQPGAGGTPGGPGGGGSPPRYATLEHPFHCPRVLKVPSYLSY
KFLGERDCAAPCEPARPDGSMFFSQEETRFARLWILTWSVLCCASTFFTVTTYLVDMQRF
RYPERPIIFLSGCYTMVSVAYIAGFVLQERVVCNERFSEDGYRTVVQGTKKEGCTILFMM
LYFFSMASSIWWVILSLTWFLAAGMKWGHEAIEANSQYFHLAAWAVPAVKTITILAMGQI
DGDLLSGVCFVGLNSLDPLRGFVLAPLFVYLFIGTSFLLAGFVSLFRIRTIMKHDGTKTE
KLERLMVRIGVFSVLYTVPATIVIACYFYEQAFREHWERSWVSQHCKSLAIPCPAHYTPR
MSPDFTVYMIKYLMTLIVGITSGFWIWSGKTLHSWRKFYTRLTNSRHGETTV
Download sequence
Identical sequences G3N2W8
ENSBTAP00000056239 ENSBTAP00000056239

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]