SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSBTAP00000056325 from Bos taurus 69_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSBTAP00000056325
Domain Number 1 Region: 2-120
Classification Level Classification E-value
Superfamily POZ domain 2.09e-34
Family BTB/POZ domain 0.0006
Further Details:      
 
Domain Number 2 Region: 320-369
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.000000000000387
Family Classic zinc finger, C2H2 0.0073
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSBTAP00000056325   Gene: ENSBTAG00000018199   Transcript: ENSBTAT00000065441
Sequence length 479
Comment pep:known chromosome:UMD3.1:2:121847012:121901991:-1 gene:ENSBTAG00000018199 transcript:ENSBTAT00000065441 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MEISSHQSHLLQQLNEQRRQDVFCDCSILVEGKVFKAHRNVLFASSGYFKMLLSQNSKET
SQPTTATFQAFSPDTFTVILDFVYSGKLSLTGQNVIEVMSAASFLQMTDVISVCKTFIKS
SLDISEKEKDRYFSLSDKDANSNGIERSSFYSSGWQDESSSPRSHLSPDQGTGIISGKSW
SKYNYHPASQRNTQQPLTKHEQRKDSIKKAKHLRLSQPSEMTHYKSSKREARTSDSSSHA
SQSEEQAQMNAEMDSTPVSYQYGQGSDVTSRSFPVEPSHTSLMKRSTSSIHKSTSLYNCD
DELSGDLNCLLTDDLPRMRFKCPYCTHVVKRKADLKRHLRCHTGERPYPCQACGKRFSRL
DHLSSHFRTIHQACKLICRKCKRHVTDLTGQVVQEGTRRYRLCNECLAEVGIDSLPIDLE
AEQHLMSPSDGDKDSRWHMGEDENRSYVEIVEDGSADLVIQQVDDSEEEEEKEIKPNIR
Download sequence
Identical sequences G3N351
ENSBTAP00000056325 ENSBTAP00000056325

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]