SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSBTAP00000056330 from Bos taurus 69_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSBTAP00000056330
Domain Number 1 Region: 46-137
Classification Level Classification E-value
Superfamily Retrovirus capsid dimerization domain-like 2.93e-39
Family SCAN domain 0.0000575
Further Details:      
 
Domain Number 2 Region: 353-410
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 3.48e-25
Family Classic zinc finger, C2H2 0.0031
Further Details:      
 
Domain Number 3 Region: 409-466
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.19e-23
Family Classic zinc finger, C2H2 0.0039
Further Details:      
 
Domain Number 4 Region: 521-573
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 2.17e-23
Family Classic zinc finger, C2H2 0.0038
Further Details:      
 
Domain Number 5 Region: 465-522
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 2.78e-23
Family Classic zinc finger, C2H2 0.0028
Further Details:      
 
Domain Number 6 Region: 315-367
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.75e-18
Family Classic zinc finger, C2H2 0.0015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSBTAP00000056330   Gene: ENSBTAG00000010255   Transcript: ENSBTAT00000065887
Sequence length 573
Comment pep:known chromosome:UMD3.1:24:22025794:22088410:1 gene:ENSBTAG00000010255 transcript:ENSBTAT00000065887 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSAQSVEEDSILIIPTPDEEEKILRVKLEEDPDGEEGSSIPWNHLPDPEVFRQRFRQFGY
QDSPGPREAVSQLRELCRLWLRPETHTKEQILELVVLEQFVAILPKELQTWVREHHPENG
EEAVTVLEDLESELDDPGQPVSLRRRKREVLVEEIVSQEEAQGLPSSELDAVENQLKWAS
WELHSLRHCGEDRNSVWAGEFIGIKMKFCLRLLWASFLEVVEGNTFSLCTSFLSASAHPL
VTIHQSLKFQFLFISDDDARTENGALAPKQEIPSAGESHEVPGTLNIGVPQIFKYGETCF
PKGRFERKRNPSRKKQHICDECGKHFSQGSALILHQRIHSGEKPYGCVECGKAFSRSSIL
VQHQRVHTGEKPYKCLECGKAFSQNSGLINHQRIHTGEKPYECVQCGKSYSQSSNLFRHQ
RIHTGERPYACQDCSKAFSLRSDLVRHWRIHSGEKPYGCCECGKAFRGSSELIRHQRIHT
GEKPYGCGECGRAFSRSSALTQHKKIHTGDKGYECTECGKAFSRSSILIEHQRIHTGEKP
YECNACGKSFNQNSALTQHQRIHTGEKPYECSE
Download sequence
Identical sequences G3N356
ENSBTAP00000056330 ENSBTAP00000056330

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]