SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSBTAP00000056439 from Bos taurus 69_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSBTAP00000056439
Domain Number 1 Region: 285-452,532-702
Classification Level Classification E-value
Superfamily PLC-like phosphodiesterases 7.79e-121
Family Mammalian PLC 0.00000119
Further Details:      
 
Domain Number 2 Region: 127-284
Classification Level Classification E-value
Superfamily EF-hand 5.02e-45
Family EF-hand modules in multidomain proteins 0.014
Further Details:      
 
Domain Number 3 Region: 720-836
Classification Level Classification E-value
Superfamily C2 domain (Calcium/lipid-binding domain, CaLB) 2.56e-28
Family PLC-like (P variant) 0.0008
Further Details:      
 
Domain Number 4 Region: 2-113
Classification Level Classification E-value
Superfamily PH domain-like 2.64e-25
Family Pleckstrin-homology domain (PH domain) 0.0034
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSBTAP00000056439   Gene: ENSBTAG00000008307   Transcript: ENSBTAT00000065611
Sequence length 1676
Comment pep:known chromosome:UMD3.1:1:112962334:113071514:1 gene:ENSBTAG00000008307 transcript:ENSBTAT00000065611 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
VERCMSVMQSGTQMIKLKRGTKGLVRLFYLDEHRTRLRWRPSRKSEKAKILIDSIYKVTE
GRQSEIFHRQAEGNFDPSCCFTIYHGNHMESLDLITSNPEEARTWITGLKYLMAGISDED
SLAKRQRTHDQWVKQTFEEADKNGDGLLNIEEIHQLMHKLNVNLPRRKVRQMFQEADTDE
NQGTLTFEEFCVFYKMMSLRRDLYLLLLSYSDKKDHLTVEELAQFLKVEQKMTNVTTDYC
IDIIRKFEVSEENKVKNVLGIEGFTNFMRSPACDIFNPLHHEVYQDMDQPLCNYYIASSH
NTYLTGDQLLSQSKVDMYARVLQEGCRCVEVDCWDGPDGQPVVHHGYTLTSKILFRDAAH
PINKHAFVKNEFPVILSIENHCSIQQQRKIAQYLKGIFQDKLDLSSIDTGETKQLPSPQS
LKGKILVKGKKLPYHLGDDAEEGEVSDEDSADEIEDECKFKLHYNNGTTEHQVESFIRKK
LESLLKESQIRDKEDPDSFTVRALLKATHEGLNAHLKQHPDAKESGKKAHGRSLMTNFGK
HKETSAVNVLKYKFDKGSTLNQRAGREGGGVFYRLGRRRKTMKLCRELSDLVVYTNSVAA
QDIVDDGTTGNVLSFSETRAHQVVQQKSEQFMIYNQKQLTRIYPSAYRIDSSNFNPLPYW
NAGCQLVALNYQSEGRMMQLNRAKFKTNGNCGYVLKPQQMCKGTFNPFSGDPLPANPKKQ
LILKVISGQQLPKPPDSMFGDRGEIIDPFVEVEIIGLPVDCSKDQTRVVDDNGFNPVWEE
TLTFTVHMPEIALVRFLVWDHDPIGRDFVGQRTVTFSSLVPGYRHVYLEGLTEASIFVHI
TINEIYGKWSPLILNPSYTILHFLGATKNRQLQGLKGLFNKNPRHNSSENTCHYIRKRSI
GDKILRRTASAPAKGRKKSKMGFQEMVEMKDSVSEAARDQDGVLRRTTRSLQARPVSMPV
DRSLLGALSLPVSETTKDTEGKENSQAEDKDARRDGKASVKDQHLPNFNKKLSSSSSALI
HKDISQGNSAVSTANLSITEQLVPGPKGGRTKSNMLSDCWEHQCLSRSLSPRQHLAHDPA
VSPSKDLCGVKTKENGNAGGFVVGKSTLSGSILSQSNLEIKKLEGNWDKGRAATSFSLSD
VSTLCSDAPDLHSTAILQESEISHLIDNVTLTNENEPGSSISALIGQFDETGNQANPTVV
SHLQSPSVMSGHPPVPTMDLKMPFKPGFSNGKPKSSFLCSSPEQIALSGHETCECSTHTA
VGETMCTPVSKMKPDNDLSGKAMTGAIENNLPQSSNTSHCWLPESPTHGKDWEILKNPSP
ATSTDLTLEDVIAAPTLSLNSGESSLVEMDGDSENLSLTTYEYRREGTSHLTSPLKVKYS
PAAVEHFQRGLRNGYCKETLHPSVSEIFNNTQDVKNQNISHLAYQGAGFMHNHFSNSDAK
TNQTSGPLPCAHDLHAPAPEQSTHSALKLSSPCKSKSLGDLTSEDIACNFESKYQCISKS
FVTTGIRDKKGMTVKTKSLEPMDALTEQLRKLVSFDQEDGCQVLYSKQDANQFPRALVRK
LSSRSQSRVRNIASRAKEKQEANRQKSVNPSTVGGVVLRSKPCAPAPTGNRHSTGSYIAG
YLRSAKGGSLEGRGIPEGACAALRSGHVDRFCSHHSVLQTEPSSDDKPEIYFLLRL
Download sequence
Identical sequences G3N3D6
ENSBTAP00000056439 ENSBTAP00000056439

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]