SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSBTAP00000056465 from Bos taurus 69_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSBTAP00000056465
Domain Number 1 Region: 306-363
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 7.52e-23
Family Classic zinc finger, C2H2 0.0057
Further Details:      
 
Domain Number 2 Region: 251-307
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.14e-19
Family Classic zinc finger, C2H2 0.015
Further Details:      
 
Domain Number 3 Region: 194-251
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 8.22e-19
Family Classic zinc finger, C2H2 0.01
Further Details:      
 
Domain Number 4 Region: 348-400
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.18e-18
Family Classic zinc finger, C2H2 0.0088
Further Details:      
 
Domain Number 5 Region: 156-208
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 3.15e-17
Family Classic zinc finger, C2H2 0.0083
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSBTAP00000056465   Gene: ENSBTAG00000046837   Transcript: ENSBTAT00000066296
Sequence length 560
Comment pep:known chromosome:UMD3.1:7:17610091:17611773:1 gene:ENSBTAG00000046837 transcript:ENSBTAT00000066296 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MRRSVLVRNPGHKGRRPDYEELDSDSEDLDPDPEELDPASEKQEPEPEDLHTVSEDVDPS
YEDLEPVSEALDAEADAPGSISGIRDSDPQDLDPLSSSFDDPDVIGPVPLILDPNSDTLS
PTASPDLDSLSSDLPATPEVLTAAPAVLPAPASPPRPFSCPDCGRAFRRSSGLSQHRRTH
SGEKPYRCPDCGKSFSHGATLAQHRGIHTGARPYQCAACGKAFGWRSTLLKHRSSHSGEK
PHHCPVCGKAFGHGSLLAQHLRTHGGPRPHKCPVCAKGFGQGSALLKHLRTHTGERPYPC
PQCGKAFGQSSALLQHQRTHTAERPYRCPHCGKAFGQSSNLQHHLRTHTGERPYACPHCS
KAFGQSSALLQHLHVHSGERPYRCQLCGKAFGQASSLTKHKRVHEGAAAAAAAAAAAAGL
GLSPASMLRPGQASLLGPDAVSVLSPGPSSGLDRDPGSGLGSLPNPNLKPTSGSGSSPSP
DSALSSDPKPGHNANSDLLASPDHRSGPSPDTDPVPSPDSNSKSHPDPGSPICDTVSPAL
PTGESPRWVQEQEALLGPDG
Download sequence
Identical sequences G5E6Q2
ENSBTAP00000056465 XP_010796552.1.59421 XP_010805177.1.76553 ENSBTAP00000056465

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]